KEGG   Roseiflexus sp. RS-1: RoseRS_2484Help
Entry
RoseRS_2484       CDS       T00542                                 

Definition
(GenBank) cytochrome c, class I
  KO
K08738  cytochrome c
Organism
rrs  Roseiflexus sp. RS-1
Pathway
rrs02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rrs00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    RoseRS_2484
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3
Motif
Other DBs
NCBI-ProteinID: ABQ90861
UniProt: A5UW58
Position
3073294..3073710
Genome map
AA seq 138 aa AA seqDB search
MQPLMRMAIGVALVLGALLLAANTLGNRSGPPASGPVAGDPERGRIVFERAGCSACHAPT
TEFRVGTGMAGVLQPEGPVYPPGVDYRGALPNGAPRTEENVAAFIRTTNQGQIGLMPGRA
LNDQQMADLLAYLRTLRR
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
atgcaaccattaatgcgcatggcaattggtgtggcgctggtgcttggggcgctcctgctg
gcggcaaatacgctcggcaatcgctccggtccgcctgcaagcggaccggttgccggcgac
cctgagcgcgggcggatcgtctttgagcgcgccggatgcagcgcctgccacgcacccacg
accgaatttcgcgtcgggaccggcatggcgggcgtgttgcaaccggaaggtccggtctat
ccgccgggagtggactaccgcggcgcgctccccaacggcgcgccgcgcaccgaggagaac
gtcgccgcctttatccgcacgaccaatcaggggcagatcggactgatgccagggcgcgcc
ctgaacgatcagcagatggccgatcttcttgcgtatttgcgaacgctgagaaggtaa

DBGET integrated database retrieval system