KEGG   Roseiflexus sp. RS-1: RoseRS_2512Help
Entry
RoseRS_2512       CDS       T00542                                 

Definition
ROK family protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
rrs  Roseiflexus sp. RS-1
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:rrs01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:rrs00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:rrs00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:rrs00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:rrs00520]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:rrs00521]
Metabolism; Biosynthesis of other secondary metabolites; Butirosin and neomycin biosynthesis
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3107296..3108318
Genome map
AA seq 340 aa AA seqDB search
MHCKIFKIEKKMSVYLGIDLGGTKIAAAAVDVRTGERLLQLIVPTEAHEGPAAVIERMAA
LAAQVCTQANVALEHIPAIGIGVPGVIDLERGVTVLLPNLPSGWRNVPLAANITHLTGRP
TAIINDARAFTLAEATFGAGRDASSVVGITLGTGIGGGIAFNGRLHLGIDGTAGEVGHMT
IDPYGPRCGCGNRGCLETFASGPSITAMGLRAVAQGMTTQIGALVDYDLNKITPGVIARA
AENGDTVAREILQRAGSYLGIGIANLITIFSPERVVIGGGLSRLGEWLLEPARAEVTARC
HLTPLDRVQIMLAQLGGEAGVIGAAVWAAQRYPAWSMDVR
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgcattgcaaaatcttcaaaatagagaagaaaatgagtgtctacctcggcatcgatctg
ggcggcaccaagatcgccgcagccgccgttgatgtacgcaccggcgagcgcctgctgcaa
ctgattgtccccaccgaagcccacgagggaccggcggcggtcatcgagcgcatggcagcg
ctggcggcacaggtttgcactcaagccaatgttgcgctcgaacatattccggcgattggc
attggcgtacccggcgtcatcgatctggagcgcggagttacagtgttgctacccaatctg
ccatcaggctggcggaatgttccgctcgccgccaacattactcatcttaccggtcgcccg
acggcaattatcaatgatgcgcgcgcgtttaccctggcggaggcgacctttggcgccggg
cgcgatgcgtccagcgtcgtcggcatcacgctgggcaccggcattggcggcggtattgcg
ttcaatgggcgactgcacctgggcatcgacggcactgctggcgaggtcgggcatatgacg
atcgacccgtacggaccgcgctgcggctgcggcaaccggggctgcctggagacattcgcc
agcggtccttcgatcacggcgatggggttgcgcgctgttgcccagggaatgacaacccag
atcggcgcgctggtggactatgatctgaacaagatcacgcccggcgtcattgcgcgcgcc
gccgagaatggcgacacggttgcgcgcgagatccttcagcgcgccgggagttatctcggc
atcggcatcgccaacctgatcacgatcttcagccccgaacgtgtcgtgatcggcggcgga
ctgtcgcgcctgggtgagtggcttctcgaaccggcgcgcgctgaggtgacagcgcgttgc
catctcactccgctcgatcgcgttcagattatgctggcgcaactgggcggcgaggcgggc
gtgatcggcgcagcagtgtgggcagcgcaacgctaccctgcatggtcaatggacgttcgg
tga

DBGET integrated database retrieval system