KEGG   Roseiflexus sp. RS-1: RoseRS_2512Help
Entry
RoseRS_2512       CDS       T00542                                 

Definition
ROK family protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
rrs  Roseiflexus sp. RS-1
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rrs00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RoseRS_2512
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RoseRS_2512
   00052 Galactose metabolism
    RoseRS_2512
   00500 Starch and sucrose metabolism
    RoseRS_2512
   00520 Amino sugar and nucleotide sugar metabolism
    RoseRS_2512
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    RoseRS_2512
   00524 Butirosin and neomycin biosynthesis
    RoseRS_2512
Enzymes [BR:rrs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     RoseRS_2512
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3107296..3108318
Genome map
AA seq 340 aa AA seqDB search
MHCKIFKIEKKMSVYLGIDLGGTKIAAAAVDVRTGERLLQLIVPTEAHEGPAAVIERMAA
LAAQVCTQANVALEHIPAIGIGVPGVIDLERGVTVLLPNLPSGWRNVPLAANITHLTGRP
TAIINDARAFTLAEATFGAGRDASSVVGITLGTGIGGGIAFNGRLHLGIDGTAGEVGHMT
IDPYGPRCGCGNRGCLETFASGPSITAMGLRAVAQGMTTQIGALVDYDLNKITPGVIARA
AENGDTVAREILQRAGSYLGIGIANLITIFSPERVVIGGGLSRLGEWLLEPARAEVTARC
HLTPLDRVQIMLAQLGGEAGVIGAAVWAAQRYPAWSMDVR
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgcattgcaaaatcttcaaaatagagaagaaaatgagtgtctacctcggcatcgatctg
ggcggcaccaagatcgccgcagccgccgttgatgtacgcaccggcgagcgcctgctgcaa
ctgattgtccccaccgaagcccacgagggaccggcggcggtcatcgagcgcatggcagcg
ctggcggcacaggtttgcactcaagccaatgttgcgctcgaacatattccggcgattggc
attggcgtacccggcgtcatcgatctggagcgcggagttacagtgttgctacccaatctg
ccatcaggctggcggaatgttccgctcgccgccaacattactcatcttaccggtcgcccg
acggcaattatcaatgatgcgcgcgcgtttaccctggcggaggcgacctttggcgccggg
cgcgatgcgtccagcgtcgtcggcatcacgctgggcaccggcattggcggcggtattgcg
ttcaatgggcgactgcacctgggcatcgacggcactgctggcgaggtcgggcatatgacg
atcgacccgtacggaccgcgctgcggctgcggcaaccggggctgcctggagacattcgcc
agcggtccttcgatcacggcgatggggttgcgcgctgttgcccagggaatgacaacccag
atcggcgcgctggtggactatgatctgaacaagatcacgcccggcgtcattgcgcgcgcc
gccgagaatggcgacacggttgcgcgcgagatccttcagcgcgccgggagttatctcggc
atcggcatcgccaacctgatcacgatcttcagccccgaacgtgtcgtgatcggcggcgga
ctgtcgcgcctgggtgagtggcttctcgaaccggcgcgcgctgaggtgacagcgcgttgc
catctcactccgctcgatcgcgttcagattatgctggcgcaactgggcggcgaggcgggc
gtgatcggcgcagcagtgtgggcagcgcaacgctaccctgcatggtcaatggacgttcgg
tga

DBGET integrated database retrieval system