KEGG   Roseiflexus sp. RS-1: RoseRS_2512Help
Entry
RoseRS_2512       CDS       T00542                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
rrs  Roseiflexus sp. RS-1
Pathway
rrs00010  Glycolysis / Gluconeogenesis
rrs00052  Galactose metabolism
rrs00500  Starch and sucrose metabolism
rrs00520  Amino sugar and nucleotide sugar metabolism
rrs00521  Streptomycin biosynthesis
rrs01100  Metabolic pathways
rrs01110  Biosynthesis of secondary metabolites
rrs01120  Microbial metabolism in diverse environments
rrs01130  Biosynthesis of antibiotics
rrs01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rrs00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RoseRS_2512
   00052 Galactose metabolism
    RoseRS_2512
   00500 Starch and sucrose metabolism
    RoseRS_2512
   00520 Amino sugar and nucleotide sugar metabolism
    RoseRS_2512
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    RoseRS_2512
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    RoseRS_2512
Enzymes [BR:rrs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     RoseRS_2512
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK FGGY_N BcrAD_BadFG
Motif
Other DBs
NCBI-ProteinID: ABQ90889
UniProt: A5UW86
Position
3107296..3108318
Genome map
AA seq 340 aa AA seqDB search
MHCKIFKIEKKMSVYLGIDLGGTKIAAAAVDVRTGERLLQLIVPTEAHEGPAAVIERMAA
LAAQVCTQANVALEHIPAIGIGVPGVIDLERGVTVLLPNLPSGWRNVPLAANITHLTGRP
TAIINDARAFTLAEATFGAGRDASSVVGITLGTGIGGGIAFNGRLHLGIDGTAGEVGHMT
IDPYGPRCGCGNRGCLETFASGPSITAMGLRAVAQGMTTQIGALVDYDLNKITPGVIARA
AENGDTVAREILQRAGSYLGIGIANLITIFSPERVVIGGGLSRLGEWLLEPARAEVTARC
HLTPLDRVQIMLAQLGGEAGVIGAAVWAAQRYPAWSMDVR
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgcattgcaaaatcttcaaaatagagaagaaaatgagtgtctacctcggcatcgatctg
ggcggcaccaagatcgccgcagccgccgttgatgtacgcaccggcgagcgcctgctgcaa
ctgattgtccccaccgaagcccacgagggaccggcggcggtcatcgagcgcatggcagcg
ctggcggcacaggtttgcactcaagccaatgttgcgctcgaacatattccggcgattggc
attggcgtacccggcgtcatcgatctggagcgcggagttacagtgttgctacccaatctg
ccatcaggctggcggaatgttccgctcgccgccaacattactcatcttaccggtcgcccg
acggcaattatcaatgatgcgcgcgcgtttaccctggcggaggcgacctttggcgccggg
cgcgatgcgtccagcgtcgtcggcatcacgctgggcaccggcattggcggcggtattgcg
ttcaatgggcgactgcacctgggcatcgacggcactgctggcgaggtcgggcatatgacg
atcgacccgtacggaccgcgctgcggctgcggcaaccggggctgcctggagacattcgcc
agcggtccttcgatcacggcgatggggttgcgcgctgttgcccagggaatgacaacccag
atcggcgcgctggtggactatgatctgaacaagatcacgcccggcgtcattgcgcgcgcc
gccgagaatggcgacacggttgcgcgcgagatccttcagcgcgccgggagttatctcggc
atcggcatcgccaacctgatcacgatcttcagccccgaacgtgtcgtgatcggcggcgga
ctgtcgcgcctgggtgagtggcttctcgaaccggcgcgcgctgaggtgacagcgcgttgc
catctcactccgctcgatcgcgttcagattatgctggcgcaactgggcggcgaggcgggc
gtgatcggcgcagcagtgtgggcagcgcaacgctaccctgcatggtcaatggacgttcgg
tga

DBGET integrated database retrieval system