KEGG   Roseiflexus sp. RS-1: RoseRS_2521Help
Entry
RoseRS_2521       CDS       T00542                                 

Definition
(GenBank) tryptophan synthase, beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
rrs  Roseiflexus sp. RS-1
Pathway
rrs00260  Glycine, serine and threonine metabolism
rrs00400  Phenylalanine, tyrosine and tryptophan biosynthesis
rrs01100  Metabolic pathways
rrs01110  Biosynthesis of secondary metabolites
rrs01130  Biosynthesis of antibiotics
rrs01230  Biosynthesis of amino acids
Module
rrs_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rrs00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RoseRS_2521
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    RoseRS_2521
Enzymes [BR:rrs01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     RoseRS_2521
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ABQ90898
UniProt: A5UW95
Position
3115953..3117173
Genome map
AA seq 406 aa AA seqDB search
MTSSVHQDPTIDTVRSGRFGPYGGAYIPETLATSVTALEQAYAAARQDPAFWAELDRLHR
SYTGRPTPLTFARRLTEYLGGAQIYLKREDLAHTGAHKINNALGQGLLAKRMGKRRIIAE
TGAGQHGVATATVCALLGMECVVYMGVDDMARQQPNVFRMRLLGAEVRGVASGSRTLKDA
INEAMRDWVTNPDSYYLLGSALGPHPYPTMVRDFQSIIGREAREQILAATGRLPDVVLAC
VGGGSNAIGIFSAFIADEGVELRGVEAGGRGTTLGDHAARFSGGRPGVLQGTYTYVLQND
DGQIGLTHSISAGLDYAAVGPEHALLHDQGRATYTTADDEEALDAFQTLARLEGIIPALE
SAHAVAEAIKIAPAMRPDQIILINLSGRGDKDIFTVARALGVEVGG
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgacgtcgagcgtgcatcaggatccgaccattgatactgtccgatccggtcgttttggt
ccctacggcggcgcctacattcccgaaacgctggcaacgtcagttacggcgctcgagcag
gcgtatgcggctgcgcgtcaggaccccgccttctgggcggaactggatcgtctgcaccgc
agttataccgggagaccgacaccgctcaccttcgcccggcgtctgacggaataccttggc
ggagcgcagatctatctcaagcgagaagacctggcgcacaccggcgcgcacaagatcaac
aatgcgctcggtcaggggttgctggcaaaacgtatgggcaaaaggcggatcatcgccgaa
accggcgccgggcagcatggtgttgcgacggcgactgtgtgcgccctgctggggatggaa
tgtgtggtctacatgggtgtcgatgacatggcgcgccagcaaccgaatgttttccgcatg
cgcctgctgggtgcggaggtgcgtggggtcgccagcggctcccgtacccttaaggatgcc
atcaacgaagccatgcgcgactgggtgaccaatccggactcctattatctgctcggttcg
gcgctcggtccgcatccgtacccgaccatggtgcgcgactttcagagcatcatcggacga
gaggcgcgcgaacagattcttgcggcgaccgggcgtttgcccgatgttgtgctggcatgc
gttggcggcggctcgaatgccatcggcatcttcagtgcgttcattgccgatgaaggggtt
gaactgcgcggcgttgaggcagggggacgcggtacgacccttggtgaccacgccgcgcgc
ttctccggcgggcgaccgggagtgttgcagggaacctacacgtatgtgttgcagaacgac
gatgggcagatcggattgacgcacagcatttcggctggtctcgactatgctgcggttgga
ccggagcacgcgctgcttcacgatcaggggcgcgccacctacaccacagccgatgacgaa
gaagcgctcgacgcctttcagacgctggcgcgactcgaagggatcatcccggcgctggag
agcgctcacgcggtagccgaagcgatcaagatcgcgcctgccatgcgcccggatcagatc
atcctgattaacctgtcggggcgcggtgacaaagacattttcactgttgcgcgggcgctg
ggagtggaggttgggggttga

DBGET integrated database retrieval system