KEGG   Roseiflexus sp. RS-1: RoseRS_2866Help
Entry
RoseRS_2866       CDS       T00542                                 

Definition
(GenBank) 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
  KO
K00950  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
rrs  Roseiflexus sp. RS-1
Pathway
rrs00790  Folate biosynthesis
rrs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rrs00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    RoseRS_2866
Enzymes [BR:rrs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     RoseRS_2866
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HPPK
Motif
Other DBs
NCBI-ProteinID: ABQ91234
UniProt: A5UX81
Position
3575951..3576451
Genome map
AA seq 166 aa AA seqDB search
MAQHETTVYIGLGSNIGDRVARLRESVVRLSQVIKVTRASRLYVQAPLGYVSQHAFINAV
VEGRTTLKPFDLLVELQKIERAMGRRRGIQYGPRPIDLDILFYGTAQMESFELTIPHPRL
AQRAFVLKPLAELAPDLMHPVLYYTVTQLLADVDDADQVKLYDPGV
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagcatgaaacaaccgtctatatcgggcttggcagcaacattggtgaccgcgtt
gcccggctacgggaatcggtcgtgcgtttgagccaggtcatcaaggttacgcgcgcctca
cgcctgtatgtgcaggcgccgctgggctatgtcagccagcatgcgttcatcaatgcagtg
gttgaaggtcgcacgacgctcaagccgttcgatctgctggttgaactgcaaaagatcgaa
cgtgctatggggcggcgccgggggattcagtacggtccgcgccctatcgatcttgacatt
ctcttttacggtacggcgcagatggagtcgtttgaattgaccatcccccacccccgtctg
gctcagcgcgcattcgtcctgaagccgcttgccgaacttgcgcccgatctgatgcacccg
gtgttgtactataccgtcacccagttacttgccgatgtcgatgatgccgaccaggtgaaa
ctgtacgatccaggcgtctga

DBGET integrated database retrieval system