KEGG   Roseiflexus sp. RS-1: RoseRS_2884Help
Entry
RoseRS_2884       CDS       T00542                                 

Definition
xylose isomerase (EC:5.3.1.5)
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
rrs  Roseiflexus sp. RS-1
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rrs00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    RoseRS_2884
   00051 Fructose and mannose metabolism
    RoseRS_2884
Enzymes [BR:rrs01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     RoseRS_2884
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3598119..3599288
Genome map
AA seq 389 aa AA seqDB search
MSDMYEPKPEHKFTFGLWTVGNIGRDPFGEPVRQPLSPVEIVHLLAEVGAYGVNFHDNDL
IPIDATPADRDRILREFKAALQETGLVVPMATTNLFADPVFKDGAFTSNDPKVRAYALQK
TMRAIDLGVECGAKVYVFWGGREGVESDAAKDPQEGLKRYREAINFLCAYVKDQGYDLKF
ALEPKPNEPRGDIYLATVGHALAFINTLDYPDMVGLNPEVAHETMAGLNFLHGVAQAWDA
GKLFHIDLNDQVIGRYDQDFRFGAVNLKAAFFLVRFLEKVGYQGSRHFDAHAYRTEDYEG
VKAFARGCMRTYLILKEKARRFDEDAEIQALLAEISADDGSMAPFQGGYSREKAAALKAH
PFDRAALGRRGLAYERLDQLTNELLLGVR
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacatgtacgaacccaaacccgaacacaaattcaccttcggactctggacggtt
ggcaacatcgggcgtgatccgttcggcgaaccggtgcgccagcctctttcgccggtcgaa
atcgtccatctgctggcggaagttggcgcgtatggcgtcaatttccacgacaacgacctg
atcccgatcgatgcaacaccggcggatcgcgaccgcattctacgcgagttcaaggcggcg
ctccaggaaaccggcctcgttgtgccgatggcgacgaccaacctctttgccgatccggtc
ttcaaggatggcgcctttacctcgaacgatcctaaagtgcgcgcatacgcgctacaaaaa
acaatgcgcgcaatcgatctgggcgttgaatgtggcgcgaaggtgtacgttttctggggc
ggtcgcgaaggcgttgagagtgacgcggcgaaggatccgcaggaagggttgaaacgctac
cgcgaagcgatcaatttcctctgcgcctatgtgaaagaccaggggtacgacctgaaattc
gcgctcgaacccaagccgaacgagccgcgcggcgacatctatctggcgactgtcgggcac
gcgctggcgttcatcaacacgctcgactacccggacatggtcgggctgaacccggaagtc
gcccatgaaacaatggcaggactgaacttcctgcacggcgtcgcgcaggcgtgggatgct
ggcaaactgttccatatcgacctgaacgatcaggtaatcgggcgctacgatcaggatttc
cgcttcggagcggtcaatctgaaagccgccttcttcctggtgcgcttcctggaaaaggtc
gggtaccaggggagtcgtcacttcgatgcacacgcctaccgcaccgaggattatgaaggg
gtgaaagcgtttgcccgcggctgtatgcgcacctacctgatcttgaaagaaaaggcgcgc
cgctttgacgaagatgccgagattcaggcgttgctggcggaaatctctgccgacgacggc
tcgatggcgccgttccagggcggctacagccgcgaaaaggctgccgcgctcaaggcgcat
ccgttcgaccgggcggcgcttgggcgacgcgggctggcgtatgagcgcctcgatcaactg
acgaacgaattgttgctcggcgttcgttaa

DBGET integrated database retrieval system