KEGG   Roseiflexus sp. RS-1: RoseRS_2891Help
Entry
RoseRS_2891       CDS       T00542                                 

Definition
glycoside hydrolase family protein
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
rrs  Roseiflexus sp. RS-1
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:rrs00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    RoseRS_2891
  Lipid metabolism
   00561 Glycerolipid metabolism
    RoseRS_2891
   00600 Sphingolipid metabolism
    RoseRS_2891
Enzymes [BR:rrs01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     RoseRS_2891
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3608908..3610314)
Genome map
AA seq 468 aa AA seqDB search
MPPKIVFIGAGSTVFARNLMGDILSFPELADATLTLFDIDPERLRTSEIVAHKVAAALDA
RPTIEATTDRRRALDGADYAICMIQVGGYKPATVIDFEIPKKYGLRQTIADTLGIGGIMR
GLRTIPVLLSMCRDMEEVCPDVTFLQYVNPMAINCWAISRASRIKTVGLCHSVQGTAEQL
AHDIGVPVEEINYICAGINHMAFYLRFERNGEDLYPLIRKVYDEGRVPAWNRVRYEVFRR
LSYFVTESSEHFSEYTPWFIKRDRPDLIERFNIPLDEYIRRCEVQLAGWEFVQYKLDHPE
ATSADLRAMMHARAKTNPYLTDEFIEYVITAAEDLEAGKVVRSHEYGSLIIHSMETGQPR
VIYGNVPNDGLIDNLPQGCCVEVPCLVDKNGVQPTKIGALPPHLAALMQTNINVQALTVE
AALTGKREHIYHAAMLDPHTAAELDLDQIWALVDDLIAAHGDWLPVYH
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgccgccaaaaatcgtcttcatcggtgcgggcagcactgtgttcgccagaaatctgatg
ggcgacattctgagcttccccgaacttgccgacgcaacgctgacgttgttcgatattgac
ccggagcgcctgcgcacctccgagattgtggcgcacaaagtcgcagcagcgctcgatgcg
cgcccgacgattgaagcgacaactgatcgccggcgcgcactcgacggcgccgactatgcg
atctgtatgatccaggtcggcgggtataagcctgccacggtgatcgacttcgagatcccg
aagaagtatggtttgcgccagaccatcgccgacacgctcggcatcggcgggattatgcgc
gggttgcgcaccattccggtgttgttgtcgatgtgccgggatatggaagaggtctgcccg
gacgtcaccttcctgcaatacgttaatccgatggcgatcaactgctgggcgatcagtcgc
gccagccggatcaagaccgttggcttgtgccacagtgtgcagggcaccgccgaacaactg
gcgcacgatattggcgtgccggtcgaggagatcaactatatctgcgccggtatcaaccat
atggcgttctacctgcggttcgagcgcaacggcgaagacctctacccgctcatccgcaag
gtctatgacgaagggcgcgtgccagcgtggaatcgggtgcggtacgaagtcttccgtcgc
ctcagctattttgtcaccgaatcgagtgagcatttcagtgaatacacaccctggttcatc
aagcgcgatcgccccgatctgatcgagcgtttcaatattccgctggacgagtacatccgt
cgctgcgaggtgcaactggcgggttgggaattcgtgcagtacaaactcgaccatcctgaa
gcgacgagcgccgatctgcgcgcgatgatgcatgcgcgcgccaaaaccaacccatatctg
accgatgagttcatcgagtatgtcatcacagccgccgaagacctggaggcgggaaaggtc
gtgcgtagccacgaatacggctcgctgatcatccacagtatggaaacgggtcagccgcgt
gttatttatggcaacgtgccgaacgatggtctgatcgacaacctgccacagggatgctgc
gtggaagtgccgtgtctggtggataaaaacggcgttcagccgacgaagatcggcgcgttg
ccgccccatcttgccgcactgatgcaaaccaatatcaacgtccaggcgctcactgtcgag
gcggcgctgaccggcaaacgcgagcatatctaccacgcagcgatgctcgacccgcatacc
gccgccgagctcgacctggatcagatctgggcgctggtggatgacctgatcgccgcgcac
ggcgactggttgccagtgtatcattag

DBGET integrated database retrieval system