KEGG   Roseiflexus sp. RS-1: RoseRS_3170Help
Entry
RoseRS_3170       CDS       T00542                                 

Definition
(GenBank) ROK family protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
rrs  Roseiflexus sp. RS-1
Pathway
rrs00010  Glycolysis / Gluconeogenesis
rrs00052  Galactose metabolism
rrs00500  Starch and sucrose metabolism
rrs00520  Amino sugar and nucleotide sugar metabolism
rrs00521  Streptomycin biosynthesis
rrs01100  Metabolic pathways
rrs01110  Biosynthesis of secondary metabolites
rrs01120  Microbial metabolism in diverse environments
rrs01130  Biosynthesis of antibiotics
rrs01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rrs00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RoseRS_3170
   00052 Galactose metabolism
    RoseRS_3170
   00500 Starch and sucrose metabolism
    RoseRS_3170
   00520 Amino sugar and nucleotide sugar metabolism
    RoseRS_3170
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    RoseRS_3170
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    RoseRS_3170
Enzymes [BR:rrs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     RoseRS_3170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK FGGY_N DUF4445
Motif
Other DBs
NCBI-ProteinID: ABQ91531
UniProt: A5UY28
Position
complement(3993236..3994180)
Genome map
AA seq 314 aa AA seqDB search
MSMTLVLGLDFGGTKLAAGLVDLQQGSVLARRSMATPVSGGASASLQAMLAMAQALIAAA
PAPVQGVGISFGGPVAADGRTVRLSMHVAGWDQVPLARHVEGALGLPAIVANDGDAAALA
EYRFGAGQGVRHLLYLTVSTGIGGGIIIDGRLHRGERAWAGEAGHQVLKPDGPPCPCGRN
GCLEALASGLSIAREARLRLRGPDGATSALAAIPSDALTAQHVAEAAAAGDALARTVWNE
AMGWLGIGIASAANLLNPGRVVLGGGLTRAGALLFDPVRHVVARRVIDPEVSVVPAALGD
DVGILGGAALLRES
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgtctatgacactcgtccttggtctcgattttggcggcacgaaacttgccgccggtctg
gttgatcttcagcaaggcagtgtgctggcgcgccgctcgatggcaacgccggtgtccggt
ggcgcgtctgccagcctccaggcgatgctggcaatggcgcaggcgttgatcgcggctgcg
cctgcgcctgtgcagggcgtcggcatcagttttggcggaccggttgcagcggatgggcgc
acggtgcgtctctcgatgcacgttgccggatgggatcaggttcctctggcgaggcatgtc
gagggggcgcttgggttgcctgctatcgttgccaatgatggcgacgcggcagcgctggcg
gagtaccgtttcggcgccgggcagggtgtgcgccatctgctgtatctgaccgtcagcacc
ggtattggcggcggcataatcatcgacgggcgcctgcatcgtggcgaacgcgcctgggcg
ggcgaggcggggcatcaggtgctgaagcccgacggtccaccctgcccatgtgggcgcaac
ggctgtctggaggcgctggcgtcgggtttgtcgatcgcccgcgaggcacggttgcggttg
cggggacctgacggcgcaaccagcgcgctggctgccatcccgtccgatgcgttaaccgcg
cagcatgtcgcagaagcagcggcggctggcgatgcgctggcgcgcacggtgtggaacgag
gcgatgggatggttagggatcggcatcgcttcagccgccaacctgctcaatcccgggcgt
gtcgtgcttggcggcgggttgacccgcgccggtgcgctcctgttcgacccggtgcgccac
gtcgttgcgcgacgtgtgatcgatccagaagtgagcgtcgtgcctgccgcgcttggcgat
gatgttggcatcctggggggtgcggcgctgctgcgcgaatcttga

DBGET integrated database retrieval system