KEGG   Roseiflexus sp. RS-1: RoseRS_3280Help
Entry
RoseRS_3280       CDS       T00542                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
rrs  Roseiflexus sp. RS-1
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:rrs00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    RoseRS_3280
Enzymes [BR:rrs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     RoseRS_3280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4131879..4132796
Genome map
AA seq 305 aa AA seqDB search
MAVVVFGSINMDLVVRTPRLPTPGETLTGHTFFTAPGGKGANQAVACARLGVPTRMVGRV
GDDLFGEQLRASLRSFGVQDDGVLTTPGPSGVALIAVDDTAENTIVIVPGANGAVSIADI
PRLERALDGARALLLQLEVPIETVVAAARAAHTRGVTVILDPAPALPLPDELYALADIIT
PNEHEATTLTGIAVHDDQGAIAAARALIARGARRVALKLGACGALTADAEGEQFWSPFTV
TPVDTVAAGDAFNGGLAVALSEGRSFDEAIRWGLAAGALSVTRHGAQPSMPERNEVLTLL
AQEHL
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
gtggcggttgttgtcttcggcagcatcaacatggatctggtggtacgcacaccgcgcctg
ccgacgcccggtgaaacgctgaccggtcatacgttcttcaccgcgcctggcggcaaaggc
gcaaaccaggcggtcgcctgcgcccggctcggcgtgccaacccgcatggtcggtcgcgtc
ggcgatgatctgttcggcgaacaattgcgcgccagccttcgctcctttggggtgcaggat
gatggcgttctgacaacgcctggtccgtcaggagtggcgctgatcgctgtcgatgacaca
gcagagaacacaattgtgatcgttccaggcgccaatggcgctgtcagcatcgcagatatt
ccacggctggaacgggcgcttgatggcgcccgcgcgctcctgctgcaactcgaagtgccg
attgaaacggtcgttgcggcggcacgcgctgcgcacacgcgcggagtgacggtcattctc
gatccggcgccggcattgccgctgcctgacgaactgtatgcgctggcggacatcataacc
cccaatgaacacgaagcgacgaccctcaccggtatcgccgttcatgatgaccagggagca
atcgcagcagcgcgcgccttgatcgcacgtggcgcccgcagagtggcgctcaaactcggc
gcctgcggtgcgctgactgccgatgccgaaggtgagcagttctggtctcccttcaccgtc
acaccggtcgatacggtcgctgccggtgatgcattcaacggcgggctggcggttgccttg
agcgaggggcgttccttcgatgaagccatacgctggggactggcagcaggagcgctgtcg
gttaccagacatggcgcacaaccatcgatgccggaacggaacgaagtgctgaccctgctt
gcacaggagcatctgtga

DBGET integrated database retrieval system