KEGG   Roseiflexus sp. RS-1: RoseRS_3649Help
Entry
RoseRS_3649       CDS       T00542                                 

Definition
(GenBank) asparagine synthase (glutamine-hydrolyzing)
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
rrs  Roseiflexus sp. RS-1
Pathway
rrs00250  Alanine, aspartate and glutamate metabolism
rrs01100  Metabolic pathways
rrs01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rrs00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    RoseRS_3649
Enzymes [BR:rrs01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     RoseRS_3649
Peptidases [BR:rrs01002]
 Cysteine Peptidases
  Family C44
   RoseRS_3649
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asn_synthase GATase_7 GATase_6 DUF3700 NAD_synthase QueC
Motif
Other DBs
NCBI-ProteinID: ABQ92004
UniProt: A5UZF1
Position
4563920..4565914
Genome map
AA seq 664 aa AA seqDB search
MCGIVGIVNIQGDQPIHEETLRRMLAMIRHRGPDQFGIYLDDQAGLGNARLSIIDLHGGQ
QPIANEDETLWIVFNGEIFNYVELRSDLEARGHRFTTSTDTEVILHLYEDHGPACLSLLN
GQFAIALWDAREQTLFLARDRVGILPLFYTIVDGALIFGSEIKAILADPRVPRAIDPVAL
EQIFTFWSTLSPRTIFRNIVDLPPGHYLIARQGQIDIRPYWRLDFGLPVRERSEDEYIEE
LRELLIDATRIRLRADVPVGAYLSGGLDSSTVAAIVRSAAGVQLDTFSIAFSDPEFDESS
FQRQMAQFLGTDHQVAFVTHADIGRVFPEVIWHTETPILRTSPAPLFLLSQLVRDRNYRV
VLTGEGADEFLAGYDIFKEAKVRRFWARQPTSRLRPLLFRRLYPWIAGFASSNTAYLSAF
FSEGLMDTQAPDYSHRPRWRTTSRIRRFFSDEVRQAADALAQPEDRAPFYPEAFSTWDPL
QQAQYLEITTFLSQYLLAAQGDRMLMAHAVEGRFPFLDHRVIEFASRLPSRLKLRGLTEK
YILRQVSRRWLPDAIWQRAKQPYRAPIHRSFFNDARPGYVDHLLAPEYIQATGLFRPMAV
AHLRKKALSGVRLSETEDMALVGILSTHLLVEQFIRDMRMPQPLSDADDVRVCIRSGVAA
GGDR
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atgtgcgggattgtgggtatcgtcaatatccagggtgatcaaccgatccacgaagagacg
ctccgccggatgctggcaatgatccggcaccgcggacccgatcagtttggcatctatctc
gacgatcaggctggtctgggcaatgcgcgtttgagcattatcgatctgcacggcggtcaa
caaccgattgccaatgaagacgaaacgctctggatcgtcttcaacggtgagattttcaac
tatgtggaactgcgctccgacctggaagcgcgtggacatcgcttcaccaccagtaccgac
accgaggtgatcctgcacctgtacgaagatcatggaccggcgtgtctctccctgctcaac
ggtcaattcgccatcgctctctgggatgcgcgtgaacagacactcttcctggcgcgtgat
cgggttggcattctgccgttgttctacactatcgtcgatggcgcactgatcttcggttcc
gaaataaaagcaatcctggcggatccgcgcgtgccgcgagcgatcgatccggtggcgctg
gagcagattttcaccttctggagcaccctctcgccacgaacgatctttcgcaacattgtc
gatcttccgcccggacactatctgatcgcgcgccagggacagatcgacatccgaccctac
tggcgtctcgatttcggtctgccggtgcgtgagcgcagtgaagatgaatatatcgaggaa
ttgcgcgaactgctgatcgatgcaacgcggatccgcctgcgggctgatgtgccggttggc
gcgtacctgagcggcggactcgactcctcgacggtggcggcaatcgtgcgcagcgccgcc
ggagttcagctcgacaccttttcgattgcgttcagcgatcccgaattcgacgagagttct
tttcagcgccagatggcgcaattcctcggaaccgaccatcaggtggcgtttgtcacccat
gccgacatcgggcgcgtcttcccggaggtgatctggcatactgaaacgccaatcctgcgc
acctcacccgcgccgctcttcctcctctcgcagctggtgcgcgaccggaactatcgtgtg
gtgctgaccggtgaaggcgccgacgaattcctggcagggtacgacattttcaaggaagcg
aaagtgcgacgcttctgggcgcgtcaaccgacatcgcgcctgcgaccgctcctgtttcgc
cggctctatccatggatcgccgggtttgccagcagcaacacagcctatctgtcggcattt
tttagcgaaggattgatggatacgcaggcgccggactattcccatcgtccacgctggcgc
accaccagtcggatccgacgattcttcagcgacgaggtgcgtcaggctgccgatgcactg
gcgcagccggaggatcgcgcaccgttctacccggaagcgttcagcacgtgggatccattg
cagcaggcgcagtacctggaaatcaccacctttctctcgcagtacctgctcgcagcccag
ggcgatcggatgctcatggcgcacgccgtcgaggggcgcttccccttcctcgatcatcgg
gtgatcgagtttgccagccgactgccgtcacgtctgaaactgcgcggtctgaccgaaaag
tacattctgcgccaggtcagccgtcgctggctcccggacgcgatctggcagcgcgcgaag
caaccgtatcgcgcgccgatccaccggagtttcttcaacgatgcgcgtccgggctatgtc
gatcatctgctcgcgccggaatacatccaggcgacgggtctgttccgccccatggctgtt
gcgcatttgaggaagaaagcgctctccggggtgcgtctgagcgaaaccgaggatatggcg
ctggtggggattctctcgacacacctgctggttgagcagttcattcgtgacatgcgtatg
ccgcagccgctctcggatgcggatgatgtcagggtgtgcatacgaagcggcgtggcagca
ggaggagaccgatga

DBGET integrated database retrieval system