KEGG   Roseiflexus sp. RS-1: RoseRS_3811Help
Entry
RoseRS_3811       CDS       T00542                                 

Definition
protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
rrs  Roseiflexus sp. RS-1
Brite
Enzymes [BR:rrs01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     RoseRS_3811
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4765981..4766637
Genome map
AA seq 218 aa AA seqDB search
MDFANERRAMIDLLVQRGIRDRRVLDAMAQVPRHAFVPENERSFAYSDQALPIGEGQTIS
QPYMVALMVEALQLAPTDRVLEVGAGSGYAAAVLSRIVAKVHTVECREALAERAVALIQA
LGYTNITVHIGDGTQGLPDYAPFDAILVSAASPWVPAPLREQLASSGRLVIPVGGRQAQI
LLRLRREGDTLRTERLCDVRFVPLIGGHAWTAERYPER
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atggattttgccaacgagcgccgtgccatgatcgatctcctggtgcaacgcggcattcgc
gaccggcgagttctggatgcaatggcgcaggtgccgcgtcatgcgtttgtgccggagaac
gagcgatcgtttgcctacagcgatcaggcgctgccgataggagaagggcagacaatatct
cagccctacatggtggcgctgatggtcgaggcgctccagcttgctccgaccgatcgcgtt
ctggaagtcggcgccggttccggttatgcggcggcagtattgagccggattgtcgcaaag
gttcatactgtcgaatgtcgtgaggcgctggcggagcgtgcagttgcactgatccaggcg
ctggggtataccaatatcaccgtccacattggtgatgggacgcaggggttgccggattat
gcaccgttcgatgcgattctggtatcggcggcctcaccctgggtgccagcgccactccgt
gagcaactggcatcatcaggtcgcctggtgatcccggtcggcgggcgtcaggcgcagatc
ctgctgcgcttgcggcgcgaaggcgatacattgcgcaccgaacgactctgcgatgtgcgc
tttgtgccgttgattggcgggcacgcctggacggcggagcggtaccctgaacgttga

DBGET integrated database retrieval system