KEGG   Roseiflexus sp. RS-1: RoseRS_3813Help
Entry
RoseRS_3813       CDS       T00542                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
rrs  Roseiflexus sp. RS-1
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:rrs00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RoseRS_3813 (tpiA)
   01230 Biosynthesis of amino acids
    RoseRS_3813 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RoseRS_3813 (tpiA)
   00051 Fructose and mannose metabolism
    RoseRS_3813 (tpiA)
   00562 Inositol phosphate metabolism
    RoseRS_3813 (tpiA)
Enzymes [BR:rrs01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     RoseRS_3813 (tpiA)
Exosome [BR:rrs04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   RoseRS_3813 (tpiA)
  Exosomal proteins of bladder cancer cells
   RoseRS_3813 (tpiA)
  Exosomal proteins of melanoma cells
   RoseRS_3813 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4767347..4768111
Genome map
AA seq 254 aa AA seqDB search
MRTPLLAGNWKMYKTTGEARELVEGLLHGLGDVSDRKVLVCPPFTALHTVRDLVQGTPIA
LGAQDVYIEPQGAFTGAISPVMLRDLGCTYVIVGHSERRAIFGEGDELIGKKVRAALAHD
LTPILCVGETKPQRDAGEAETIVVAQVRAALAGMTPDQIARIVIAYEPVWAIGTGDTATP
ADAQAMHVTIRQTLGELAGSDVADAINILYGGSVKPDNIDDLMAQPDIDGALVGGASLKA
DSFLRIVHFLPIQG
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgcgcacgccactccttgcaggcaactggaagatgtacaaaacaaccggtgaggcacgc
gaactggtcgagggattgttgcacgggcttggtgatgtcagcgaccgaaaggtcctggtt
tgcccgccgttcactgcgctgcacacggtgcgtgatctggtgcagggcacgccgattgct
ctgggggcgcaggatgtctacatcgagccgcagggcgcctttaccggcgcgatttcaccg
gtgatgctgcgcgatcttggatgcacgtatgtgattgtcggtcacagtgaacgacgcgcc
atttttggcgaaggtgacgaactgatcggaaagaaggtccgcgccgcgctggcgcatgat
ctcacgcccatcctgtgtgtcggcgagaccaaaccgcagcgtgacgccggtgaagccgag
acaatcgttgtggcgcaggtgcgcgcggcgcttgccggtatgacaccggatcagatcgct
cgaattgtcattgcctatgagccggtctgggcgatcggcaccggcgatactgccactcct
gccgatgcacaggcgatgcatgtgacgatccggcagacgcttggcgaactggcagggtcc
gatgtggcggatgcgatcaacatcctgtacggcggcagtgtcaagcccgacaatatcgat
gacctgatggcgcaacccgatatcgatggagcactggttggcggcgcttccctcaaagcc
gacagtttcctgcgcatcgtccattttctcccgatccagggatga

DBGET integrated database retrieval system