KEGG   Roseiflexus sp. RS-1: RoseRS_3921Help
Entry
RoseRS_3921       CDS       T00542                                 

Definition
alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
rrs  Roseiflexus sp. RS-1
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rrs00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    RoseRS_3921
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RoseRS_3921
  Lipid metabolism
   00071 Fatty acid degradation
    RoseRS_3921
  Amino acid metabolism
   00350 Tyrosine metabolism
    RoseRS_3921
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    RoseRS_3921
   00626 Naphthalene degradation
    RoseRS_3921
Enzymes [BR:rrs01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     RoseRS_3921
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4905172..4906125
Genome map
AA seq 317 aa AA seqDB search
MHAIVYDGKLRQVDDYPRPVLRAGEALIRPSLVGICNTDIEITRGYMNFRGVLGHEFVGV
VVACEDAAWIGQRVVGEINAACRSCAVCRRGDESHCPNRTTLGIDRRDGAMAELFSLPIA
CLHRVPDRMPDAVAVFTEPVAAALEILQQIHLHPTDRVAVVGDGKLGLLCVQAARLPGCD
VTLVGRHPERWEFLDGLAIHAMHVNELDEAHIAGFDVVIDCTGHPHGFGVARRLVRPRGR
LVMKSTFAAESECNLTMLVVDEVRLIGSRCGPFAAALRTLDGGLITTAPLIAARFPLYDG
IRAFAAAAGRLKVLLEV
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgcacgccattgtgtacgatggcaaactgcgtcaggtcgacgactatcctcgaccagtc
ctgcgtgctggcgaggcgctcatacgtccctctcttgtcggtatctgcaacaccgatatc
gagattacgcgcggctacatgaattttcgtggcgttctggggcacgagtttgttggtgtc
gtggttgcgtgcgaagacgccgcctggatcggccagcgcgtggttggcgagatcaacgcc
gcatgccgttcgtgcgccgtctgccgacgcggtgatgaaagtcactgccccaatcgcaca
acgctcggcattgatcggcgcgacggcgcgatggcggaactgttcagcctgccgatcgcc
tgcctgcatcgcgtgccggatcgtatgccagatgcggttgccgtcttcaccgaaccggtt
gcggcagcgcttgaaatccttcagcagatacacctgcacccgacggatcgggtggcagtc
gtgggagacgggaaacttgggctgctctgcgttcaggcggcgcgattgccaggatgcgat
gtgaccctggttgggcggcatccagagcgctgggagtttctggatggtctggcgatccac
gccatgcatgtgaatgaactggatgaggcgcatatcgccggtttcgatgtcgtcatcgat
tgcaccggtcacccgcacggcttcggcgtggcgcgccggttagtccgtcctcgcgggcgc
ctggtgatgaagagcacattcgctgccgaatcggagtgcaacctgacgatgctggtcgtc
gatgaggtccggttgatcggttcgcgctgcggtccgttcgcagccgcgctccgcaccctg
gacggcgggttgatcaccacggcgccgctgatcgcagcgcggtttcccctgtatgacggc
atacgcgcctttgccgccgcagcgggtcgattgaaggtgttgctggaggtgtag

DBGET integrated database retrieval system