KEGG   Roseiflexus sp. RS-1: RoseRS_3930Help
Entry
RoseRS_3930       CDS       T00542                                 

Definition
(GenBank) succinyl-CoA synthetase (ADP-forming) beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
rrs  Roseiflexus sp. RS-1
Pathway
rrs00020  Citrate cycle (TCA cycle)
rrs00640  Propanoate metabolism
rrs00660  C5-Branched dibasic acid metabolism
rrs00720  Carbon fixation pathways in prokaryotes
rrs01100  Metabolic pathways
rrs01110  Biosynthesis of secondary metabolites
rrs01120  Microbial metabolism in diverse environments
rrs01130  Biosynthesis of antibiotics
rrs01200  Carbon metabolism
Module
rrs_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rrs_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rrs00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RoseRS_3930
   00640 Propanoate metabolism
    RoseRS_3930
   00660 C5-Branched dibasic acid metabolism
    RoseRS_3930
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    RoseRS_3930
Enzymes [BR:rrs01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     RoseRS_3930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 CPSase_L_D2 GARS_A Ribosomal_L22 ATP-grasp
Motif
Other DBs
NCBI-ProteinID: ABQ92283
UniProt: A5V080
Position
complement(4918164..4919303)
Genome map
AA seq 379 aa AA seqDB search
MKLHEYQARDILARYGIPVTGGGVATTPAEARTIAEQIGGRVVVKAQVFVGGRGKAGGVK
LADTPEQAEQVASQILGMNIKGLTVEKVLVAEAITYEREIYLGAIMDRASRRIVMMASAE
GGVEIEEVARTNPEAIVKVAAHPMMGLLDFQARDLAYGIGLTDGRQARQFAQIATALYRA
YMDVDASLAEINPLVVRADGSLQALDSKIVLDDSGLFRHPDLEAMRDSSDEPEAEQRARE
AGITYIKLDGNIGCMVNGAGLAMATMDVVKLYGGEPANFLDIGGGAGKEKVKTALQIILS
DPNVKAVMFNIFGGITRVDEVAKGIIAALEEVNTDVPMIARLVGTNEEEGRRILAESALI
PAATLAEAAEKAVQAAQSR
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgcacgagtatcaggcacgcgacatcctggcgcgctacggcataccggtgacc
ggtggcggtgtcgccacaacaccggcggaagcgcgcacaattgcggagcagattggcggt
cgggtggttgtcaaagcgcaggtatttgtaggagggcgcggcaaggcgggcggcgtcaaa
ctcgccgataccccggaacaggcggaacaggtcgccagccagatcctgggtatgaacatc
aaaggattgaccgttgagaaagtgctggttgccgaagccatcacctacgagcgcgagatc
tatctgggcgcgattatggatcgcgcctcacgacgaattgtgatgatggcatcagctgaa
ggcggtgttgaaatcgaagaagtcgccaggaccaacccggaagcgatcgtcaaagtggcg
gcgcacccgatgatggggttgctcgactttcaggcgcgcgaccttgcgtatggcattgga
ttgactgacggcaggcaggcgcgccagtttgctcagattgcgacggcgctctaccgtgcc
tacatggatgtcgatgcgtctctggcggagatcaacccgctggttgtgcgcgccgacggt
tcgcttcaggcgctcgactcgaagattgtgctggacgatagcgggttgtttcgccatccc
gatctcgaagcgatgcgcgactcgtcggatgaaccggaagccgagcagcgcgcccgcgag
gctggcattacctacatcaaactcgacggcaatatcggctgcatggtgaacggcgccggt
ctggcgatggcgacgatggatgtggtcaaactgtatggcggtgaacccgccaacttcctc
gacatcggcggcggcgcaggcaaagagaaggtcaaaaccgccctccagatcatcctctcc
gatccgaacgtcaaagcggtgatgttcaacatcttcggcggtatcacccgtgtcgatgaa
gtggcaaaaggcattatcgccgccctcgaagaagtcaacaccgacgttcccatgattgca
cgactggtcggcacgaacgaggaagaaggtcggcgcattctggcagaatcggcgctgata
ccggctgcgacgctggcggaagcggcggagaaggcggttcaggcggcgcaatcacggtaa

DBGET integrated database retrieval system