KEGG   Roseiflexus sp. RS-1: RoseRS_4164Help
Entry
RoseRS_4164       CDS       T00542                                 

Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
rrs  Roseiflexus sp. RS-1
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:rrs00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RoseRS_4164
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    RoseRS_4164
Enzymes [BR:rrs01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     RoseRS_4164
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5214021..5215307)
Genome map
AA seq 428 aa AA seqDB search
MSAVNRDQEIAELERRWATDPRWQGIRRDYSAADVVRLRGTLKIEYTLANVGARRLWDLL
QTEPYVATFGALTGAQATQMVRAGIKAIYMSGWQVAADANLAGQTYPDQSLYPSNSVPAL
VRRINNALMRADQIHASEGHNDIYWYAPIVADAEAGFGGPLHAFELTKAMIEAGASGVHF
EDQLASEKKCGHLGGKVLVPTSQFIRTLTAARLAADVLDVPTVLIARTDAQAATLLLSDA
DEYDRPFITGERTPEGFYRVKSGLDAAIARGLAYAPYADLIWCETAHPDLDEARRFAEGI
HAKFPGKMLAYNCSPSFNWKRYLDEATIATFQRELAAMGYKFQFITLAGWHMINYYAFEL
AKAYAAEGMTAYVRLQQAEFAAEQHGYTATRHQREVGTGYFDEVSTIISGGLSSTTALAG
STEEEQFH
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgtccgctgtcaatcgtgaccaggagatcgctgagctggaacggcgctgggcgaccgac
ccgcgctggcagggcatccgacgcgactacagcgccgccgatgtggtgcggttgcgcggc
accctcaagatcgagtacacgctggcgaatgtgggcgcccggcggttgtgggatctgttg
cagaccgaaccgtatgtggcgacgtttggcgcactgaccggcgcacaggcaacccagatg
gtgcgcgccgggatcaaggcgatctatatgagcggctggcaggtggctgccgacgcgaac
ctggcgggacagacctaccccgaccagagcctctatccgtcgaacagcgtcccggcgctg
gtgcgtcggatcaataacgcgctcatgcgcgccgaccagatccacgcatcggaagggcat
aacgatatttactggtatgcgccgattgtcgctgatgccgaggcagggtttggcggtccg
ctgcatgcgttcgagttgacgaaggcgatgatcgaggctggcgcgtcgggagttcacttc
gaggatcaactggcgtcggagaagaagtgtgggcacctgggtgggaaggtactggtgccg
acatcgcagtttatccgcacgctcacggcggcgcgcctggcggctgatgtgctggacgtg
ccgacggtgctgatcgcccgcaccgatgcgcaggcagcgacgctgctcctgtctgatgcc
gatgagtacgaccgcccctttatcaccggtgaacgcacaccggagggcttttaccgggtg
aagagcgggctggatgcggcaatcgcccgtggtctggcgtatgcgccctatgccgacctg
atctggtgtgagacggcgcatcccgatctggacgaggcacggcggttcgccgagggaatc
cacgcgaaattccccggcaagatgctggcgtataactgctcgccgtcgttcaactggaaa
cgctacctggatgaagcgaccatcgcaacgttccagcgcgaacttgcagcaatggggtac
aagttccagttcatcacgctggctggctggcatatgatcaactactacgccttcgaactt
gcaaaagcgtatgctgccgagggaatgaccgcgtatgtgcgattgcagcaggcggagttt
gcggctgagcagcatgggtataccgcaacgcgccatcagcgcgaggtgggaaccggctat
ttcgatgaggtgtccaccatcatttctggcggtctctcctcaacaacggcgctcgccggt
tcgaccgaagaagagcagtttcattga

DBGET integrated database retrieval system