KEGG   Roseiflexus sp. RS-1: RoseRS_4164Help
Entry
RoseRS_4164       CDS       T00542                                 

Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
rrs  Roseiflexus sp. RS-1
Pathway
rrs00630  Glyoxylate and dicarboxylate metabolism
rrs01100  Metabolic pathways
rrs01110  Biosynthesis of secondary metabolites
rrs01120  Microbial metabolism in diverse environments
rrs01200  Carbon metabolism
Module
rrs_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:rrs00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    RoseRS_4164
Enzymes [BR:rrs01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     RoseRS_4164
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: ABQ92508
UniProt: A5V0V5
Position
complement(5214021..5215307)
Genome map
AA seq 428 aa AA seqDB search
MSAVNRDQEIAELERRWATDPRWQGIRRDYSAADVVRLRGTLKIEYTLANVGARRLWDLL
QTEPYVATFGALTGAQATQMVRAGIKAIYMSGWQVAADANLAGQTYPDQSLYPSNSVPAL
VRRINNALMRADQIHASEGHNDIYWYAPIVADAEAGFGGPLHAFELTKAMIEAGASGVHF
EDQLASEKKCGHLGGKVLVPTSQFIRTLTAARLAADVLDVPTVLIARTDAQAATLLLSDA
DEYDRPFITGERTPEGFYRVKSGLDAAIARGLAYAPYADLIWCETAHPDLDEARRFAEGI
HAKFPGKMLAYNCSPSFNWKRYLDEATIATFQRELAAMGYKFQFITLAGWHMINYYAFEL
AKAYAAEGMTAYVRLQQAEFAAEQHGYTATRHQREVGTGYFDEVSTIISGGLSSTTALAG
STEEEQFH
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgtccgctgtcaatcgtgaccaggagatcgctgagctggaacggcgctgggcgaccgac
ccgcgctggcagggcatccgacgcgactacagcgccgccgatgtggtgcggttgcgcggc
accctcaagatcgagtacacgctggcgaatgtgggcgcccggcggttgtgggatctgttg
cagaccgaaccgtatgtggcgacgtttggcgcactgaccggcgcacaggcaacccagatg
gtgcgcgccgggatcaaggcgatctatatgagcggctggcaggtggctgccgacgcgaac
ctggcgggacagacctaccccgaccagagcctctatccgtcgaacagcgtcccggcgctg
gtgcgtcggatcaataacgcgctcatgcgcgccgaccagatccacgcatcggaagggcat
aacgatatttactggtatgcgccgattgtcgctgatgccgaggcagggtttggcggtccg
ctgcatgcgttcgagttgacgaaggcgatgatcgaggctggcgcgtcgggagttcacttc
gaggatcaactggcgtcggagaagaagtgtgggcacctgggtgggaaggtactggtgccg
acatcgcagtttatccgcacgctcacggcggcgcgcctggcggctgatgtgctggacgtg
ccgacggtgctgatcgcccgcaccgatgcgcaggcagcgacgctgctcctgtctgatgcc
gatgagtacgaccgcccctttatcaccggtgaacgcacaccggagggcttttaccgggtg
aagagcgggctggatgcggcaatcgcccgtggtctggcgtatgcgccctatgccgacctg
atctggtgtgagacggcgcatcccgatctggacgaggcacggcggttcgccgagggaatc
cacgcgaaattccccggcaagatgctggcgtataactgctcgccgtcgttcaactggaaa
cgctacctggatgaagcgaccatcgcaacgttccagcgcgaacttgcagcaatggggtac
aagttccagttcatcacgctggctggctggcatatgatcaactactacgccttcgaactt
gcaaaagcgtatgctgccgagggaatgaccgcgtatgtgcgattgcagcaggcggagttt
gcggctgagcagcatgggtataccgcaacgcgccatcagcgcgaggtgggaaccggctat
ttcgatgaggtgtccaccatcatttctggcggtctctcctcaacaacggcgctcgccggt
tcgaccgaagaagagcagtttcattga

DBGET integrated database retrieval system