KEGG   Roseiflexus sp. RS-1: RoseRS_4286Help
Entry
RoseRS_4286       CDS       T00542                                 

Definition
6-phosphogluconate dehydrogenase
Orthology
K00033  
6-phosphogluconate dehydrogenase [EC:1.1.1.44]
Organism
rrs  Roseiflexus sp. RS-1
Pathway
Pentose phosphate pathway
Glutathione metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:rrs01200]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:rrs00030]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:rrs00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5373335..5374234
Genome map
AA seq 299 aa AA seqDB search
MDIGITGLGRMGANMARRWLRGGHRVVVHNRSRGPIDELAAVGAVPAYTLEELIAALAPP
RAVWVMLPAGDVTERAIAALADLMTPGDTIVDAGNTMYKDDLRRADELKQRGIHYVDQGT
SGGIWGLELGYCLMVGGDADVVARLEPAFRTLAPEDGYLHCGPVGSGHFVKMVHNGVEYG
MMQAYAEGFEILRSKTGFDLDLHKIAAVWNHGSVVRSWLLELAEDAFRQDPHLESIQGYV
EDSGEGRWTIQTAIELDVPAPVITLSLFERFHSRRPESFAAKVLAALRKGFGGHPVKPA
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atggacatcggtatcaccggtcttggacgtatgggcgcgaatatggcgcgccgctggctg
cgcggcggtcaccgcgtcgtcgttcacaatcgcagtcgcggaccgatcgacgaacttgcc
gccgtcggcgctgttcctgcgtataccctcgaagaactgatcgctgcgctggcgccgccg
cgcgcggtgtgggtgatgctgccggccggcgacgtgaccgaacgcgcgattgctgcactt
gcagaccttatgacgccgggcgacacgattgttgacgctggcaacacgatgtacaaggat
gatctgcgtcgcgcggatgagctcaaacagcgcggcattcactatgtcgatcagggaacg
tccggcggcatctgggggctggaactcggttactgcctgatggtcggcggcgatgcagac
gtggttgcgcggcttgaaccggcattccgcacacttgcaccggaagatggttatctccac
tgcggaccggtcggcagcggtcattttgtgaaaatggtgcacaacggcgtcgagtacggc
atgatgcaggcatatgccgaagggttcgagatcttgcgctccaaaaccgggttcgatctc
gatctccacaagattgccgctgtctggaaccatggcagcgtggtgcggtcgtggttattg
gagttggcggaagatgcctttcggcaggacccgcatcttgagagcatccaggggtatgtg
gaagacagcggcgaagggcgctggacgatccagaccgctatcgaactcgatgttcctgca
ccggtgatcaccctgtcgctctttgagcggtttcactcgcgccgaccggaatcatttgcg
gcaaaggtgcttgccgcgttacgcaaagggtttggcgggcatcccgtcaaaccggcgtga

DBGET integrated database retrieval system