KEGG   Rhodospirillum rubrum ATCC 11170: Rru_A0058Help
Entry
Rru_A0058         CDS       T00310                                 

Definition
dihydrokaempferol 4-reductase (EC:1.1.1.219)
Orthology
K00091  
dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
rru  Rhodospirillum rubrum ATCC 11170
Brite
Enzymes [BR:rru01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.219  dihydrokaempferol 4-reductase
     Rru_A0058
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(64954..65955)
Genome map
AA seq 333 aa AA seqDB search
MTVLVTGASGFVGAAVVRALLARGQNVRALVRDTSPRRNLEGLPLETVIGDLTDTASLRA
AARGVDALYHVAADYRLWTLDPPAMFRANVEGSVAVIRAAAEAGAKRIVYTSSVAVIKPK
ADGTPADETTPTLASDMIGPYKLSKFEAERAVQRLITNEGAPVVIVNPSTPIGPRDIKPT
PTGRMIVEAALGKMPAYVDTGLNVAHVEDVAEGHLLAFDRGEIGERYILGGEDMSLRDIL
FTIARLTGGKPPRVSLPHGLIVPLAWAVETLARLRRSETEPFVTLDGLRMARKHMFFSSA
KARTALGYAPRPAEQALADALVWFRANGFLDPR
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgacagtcctcgtgaccggagcatcgggtttcgtcggcgccgccgtcgtgcgcgccctt
ctcgcccgggggcaaaacgtgcgcgccctggtgcgcgacacctcgcccaggcgtaacctt
gaaggactgccccttgaaacggtgatcggcgatctgaccgacacggcctcgctgagggcc
gccgcccgcggggtggacgcgctgtaccacgtcgccgccgactaccggctgtggacgctt
gaccctccggcgatgtttcgcgccaatgtcgagggctcggtcgccgtcatccgcgccgcc
gccgaggccggggcgaaacgcatcgtctataccagcagcgtcgccgtgatcaaacccaag
gccgatggcaccccggccgatgagaccacgcccaccctggcctccgacatgatcggccct
tataagctgtcgaagttcgaggccgagcgggcggtgcagcggctgatcaccaacgaaggc
gcgccggtggtcatcgtcaatccctcgacgccgatcggtccgcgcgacataaaaccgaca
ccgaccgggcggatgatcgtcgaagcggcgctgggcaagatgccggcctatgtcgatacc
ggcctcaacgtcgcccatgtcgaggacgtggcggaaggccatctgctggcttttgatcgc
ggagagatcggcgaacgctatattctgggcggcgaggacatgagcctgcgcgacatcttg
ttcaccatcgcccggctgaccggcggcaagcccccccgggtcagcctgccccacgggctg
atcgtacccttggcctgggcggtggaaaccctggcccggctgcggcgctccgagaccgag
cctttcgtcacccttgatggcctgcgcatggcgcgcaagcacatgttcttctcgtcggcc
aaggccagaacggcgcttggttatgccccgcgaccggccgaacaggccctggccgacgcc
ctcgtctggttccgcgccaatggctttctcgatccccgttga

DBGET integrated database retrieval system