KEGG   Rhodospirillum rubrum ATCC 11170: Rru_A0359Help
Entry
Rru_A0359         CDS       T00310                                 

Definition
class II aldolase/adducin-like protein (EC:4.1.2.17)
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
rru  Rhodospirillum rubrum ATCC 11170
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:rru00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(433576..434241)
Genome map
AA seq 221 aa AA seqDB search
MPGSRIALRHGLIDAARQVTTLGLNKGTAGNLSVRAGDGLLITPSGLQAADLRPNDIVFI
DSEGEWRGPRKPSSEWRFHHDILAERPDVGAVVHTHAPFSTVLACLGRPIPAFHYMVAMA
GGNDIRIGAYATFGTAELSRHALAAMEGRKACLLAHHGMIATGRTLKAAIKLAVEVEELA
EQYWRCLQIAEPEILPADEMERVLEKFKTYGDNAQLPSPPA
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgcccggatcgcggatcgccctgcgtcatggtttgatcgatgccgcccggcaggtgacg
accctcggcctcaacaagggaacggcgggcaatctgtcggtgcgggccggagatggcctg
ctgatcaccccctcgggtctccaggccgccgatctgcggcccaatgatatcgttttcatc
gatagcgagggggaatggcgcggcccgcgcaagccttcaagcgaatggcgctttcaccat
gacatcctagccgagcgccccgatgtcggggcggtcgtccatacccatgcccccttcagc
accgttctcgcctgtctggggcggccgatcccggctttccactacatggtggcgatggcc
ggcggcaacgacatccgcattggcgcctatgccaccttcggaaccgccgagttgtcgcgg
cacgccctggcggcgatggaggggcgcaaggcctgcctgctcgcccatcacggcatgatc
gccaccggccgcaccttgaaagccgccatcaagctggcggtcgaggtcgaggaactggcc
gaacaatattggcgctgcctgcagatcgccgaacccgagattctcccggccgacgagatg
gagcgggtgctcgaaaagttcaaaacctatggggataacgcccagctcccctccccgccc
gcctga

DBGET integrated database retrieval system