KEGG   Rhodospirillum rubrum ATCC 11170: Rru_A0429Help
Entry
Rru_A0429         CDS       T00310                                 

Gene name
gmk
Definition
(RefSeq) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
rru  Rhodospirillum rubrum ATCC 11170
Pathway
rru00230  Purine metabolism
rru01100  Metabolic pathways
Module
rru_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:rru00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Rru_A0429 (gmk)
Enzymes [BR:rru01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Rru_A0429 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 AAA_18 cobW DUF2982 ABC_tran AAA_16 CPT MMR_HSR1 AAA AAA_22 TsaE
Motif
Other DBs
NCBI-GeneID: 3833995
NCBI-ProteinID: YP_425521
UniProt: Q2RXB1
Position
501508..502164
Genome map
AA seq 218 aa AA seqDB search
MSAPSSAPALIPRRGMMLVLSSPSGAGKTTISRALLAEEDGLEMSVSVTTRAPRPGERDG
EHYHFIDVARYMALTKDDGLLEHARVFENYYGTPRAPVEAALARGCDVLFDIDWQGTQQV
AEKARTDLVSIFILPPSVGELERRLKGRAQDSDAVVAARMAKAMDEISHYFEYDYIIVND
DLDRSIADVRAILRAERLKRARRIGLAEFVNRMRGAGE
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgtcggccccttcctccgcccccgccctcatcccccggcgcggtatgatgctggttctc
tcctcgccttccggggcggggaagaccactatttcccgcgctcttctggccgaagaggac
ggattggagatgtcggtgagcgtcaccacccgggcgccgcggcccggtgaacgcgacggc
gagcattaccatttcatcgacgtcgcccgttatatggccttgaccaaggacgacggccta
cttgaacacgcccgggttttcgaaaactattacggtaccccccgggcgccggtcgaggcg
gccctggccaggggctgtgacgtcttgttcgatatcgattggcagggcacccagcaggtg
gccgaaaaggcgcggaccgatctggtcagcatcttcatcctgccgccctcggtgggggaa
ctcgaacgccggctgaagggcagggcccaggatagcgatgccgtggtggcggcgcgcatg
gccaaggcgatggacgagatcagccactacttcgaatacgattacatcatcgtcaatgat
gatctcgaccgctcgatcgccgatgtgcgggccatcttgcgggccgagcgcctgaagcgc
gcccgccggatcggtctggccgaattcgtcaaccgcatgcgcggcgccggggaatag

DBGET integrated database retrieval system