KEGG   Rhodospirillum rubrum ATCC 11170: Rru_A0445Help
Entry
Rru_A0445         CDS       T00310                                 

Definition
3'(2'),5'-bisphosphate nucleotidase (EC:3.1.3.25)
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
rru  Rhodospirillum rubrum ATCC 11170
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:rru00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(523939..524721)
Genome map
AA seq 260 aa AA seqDB search
MIDIDAPLDLVQALIPIAEKAGEEILAVYTTPFAVESKADHSPVTEADRRAEAVIIEALT
RLTPAIPIVAEEAVAAGHIPVVGDQPFWLVDPLDGTKEFVKRNGEFTVNIGLVVGGVPVL
GVVHCPALEITYWGAGLGHAVMRSRHSTRTITCRPEPEDGLTVLASRSHGSDDEMTTFLA
AFPVKARIAAGSSLKFCRIAEGTADLYPRLGPTYEWDTCAAHAVLRAAGGGVFTLDGQPL
AYAKRGDFLNPPFVARGLPA
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgatcgacatcgatgctccgctagaccttgtccaggctctgatccccatcgccgaaaag
gcgggcgaggagatcctggcggtctacaccacgcccttcgccgttgaaagcaaggccgac
cattccccggttaccgaggccgaccgccgggcggaagcggtgatcatcgaggccttgacc
cggctgaccccggccattccgatcgtcgccgaggaagccgtcgccgccggccatatcccg
gtggtcggcgatcagccgttctggctggtcgacccgctggacggcaccaaggaattcgtc
aagcgcaacggcgagttcacggtcaatatcggccttgtcgtcggcggcgtgccggtgctg
ggcgtcgtgcattgcccggccctggagatcacctattggggggccggcctcggccatgcg
gtcatgcgcagccgccacagcacgcggacgatcacctgccgcccggagcccgaggacgga
ttgaccgttctggccagccgcagccatggctcggacgacgagatgacgacctttctcgcc
gcctttccggtcaaggcccgcatcgccgccggcagcagcctgaagttctgccgcatcgcc
gagggaaccgccgatctgtatccccggcttggcccgacctatgaatgggacacctgcgcc
gcccatgcggtgctgcgcgccgccggcggtggcgtcttcaccctggacggccagcctttg
gcctatgccaagcgcggcgatttcctcaatccgcccttcgtcgcccggggattgccggcg
tga

DBGET integrated database retrieval system