KEGG   Rhodospirillum rubrum ATCC 11170: Rru_A0506Help
Entry
Rru_A0506         CDS       T00310                                 

Definition
(RefSeq) glycoside hydrolase
  KO
K01236  
maltooligosyltrehalose trehalohydrolase [EC:3.2.1.141]
Organism
rru  Rhodospirillum rubrum ATCC 11170
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:rru00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Rru_A0506
Enzymes [BR:rru01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.141  4-alpha-D-{(1->4)-alpha-D-glucano}trehalose trehalohydrolase
     Rru_A0506
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
597429..599249
Genome map
AA seq 606 aa AA seqDB search
MTRRFGARVEGDGVRFSLWAPAAERVEVVIEGAAESRPVAMVPGGEGWFGAMVGGIGAGA
LYRFRIDGADLVPDPASRFQPRDVGGPSQVVDASGYAWKTDGWKGRPWAETVLYELHLGT
FSRKGTYEGARARLGDLVDLGVSAIELMPLADFVGQRNWGYDGVLPFAPDSVYGTPEQLK
ALIDAAHGLGLMVFLDVVYNHFGPEGNWLGRYAPSFFTQAHQTPWGAAIDFERPEVRDFF
VANALQWLEEYRFDGLRFDAVHAILDAEERHILGEIAVAVREALPADRHVHLVLENDANE
ARRLIGGTDVVAVRGRYDAQWNDDIHHAFHVVATGETGGYYADYAAQPLAHLGRCLAEGF
AYQGESSAHRGGMARGEPTTALPPTAFVAFLQNHDQIGNRALGERLSTLAAPDRLRALRT
ILLLGPQIPMLFMGEEWSSSRPFLFFCDFHGDLAEAVREGRRREFAAFPQFSTPETRDRI
PDPNAPETARACVLDWSERDQPTGAAVLAHHKHLLELRFAKIVPLLGRLRPGGGRCERIG
EGGLAVRWGIDDGRDLLMLAQLAEAGSLPGAPPQADLIYRSDGGERAEAPLGPWSVLFAL
VPETSR
NT seq 1821 nt NT seq  +upstreamnt  +downstreamnt
atgacaagacggtttggcgcccgggtcgagggcgatggcgtgcggttttcgctctgggcc
cccgccgccgaacgggttgaggtggttatcgaaggcgcggccgaatcgcgccccgtcgcc
atggtgcccggcggcgagggctggtttggcgccatggtcggcggcatcggcgccggggcg
ctttatcgcttccgcattgatggcgccgatctggtgcccgatccagcctcgcgcttccag
ccccgggacgtgggcggccccagtcaggtggtcgatgcgagcggctatgcctggaagacc
gacggctggaaaggccgtccctgggcggagacggtgctttacgaactgcatctgggcacc
ttcagccgtaagggaacctatgagggggcgcgggcccgcctgggggatctggtcgatctg
ggggttagcgccatcgaattgatgccgctggccgatttcgtcggtcaacgcaattggggg
tatgacggcgtgttgcccttcgcccccgacagcgtctatggcacgcccgagcagttgaag
gcgttgatcgacgccgcccacggcctggggctgatggtttttcttgatgtcgtctataat
cacttcggccccgagggcaattggctggggcgctatgcgccaagcttcttcacccaggcc
caccagaccccctggggggcggccatcgatttcgaacggcccgaggtgcgcgatttcttc
gtggccaatgctttgcaatggctggaggagtatcgcttcgacggcctgcgcttcgatgcc
gtccacgccatcctcgatgccgaggaacgccatatcctgggcgagatcgccgtggccgtc
cgcgaggccttgccggcggaccgccacgtccatctggtgctggaaaacgatgccaatgaa
gcccgccggctgatcggcggaaccgacgtggtggcggtgcgcgggcgttatgacgcccag
tggaacgatgatatccaccacgccttccatgtggtggccaccggcgagaccggcggctat
tacgccgattacgccgcccagccgctggcccatcttggtcgttgtctggccgaaggcttc
gcctatcaaggcgagtcctcggcccatcgcggcggcatggcgcgcggcgagccgacgacg
gcgctgccgccgacggccttcgtcgcctttctgcagaaccacgatcagatcggcaatcgg
gctttgggggaaagattaagcaccctggccgcgcccgaccggttgcgcgccctgcgcacg
atcttgctgctcgggccgcagatcccgatgctgttcatgggcgaggaatggtcgagctcg
cggcccttcctgttcttttgcgatttccacggcgatctggccgaggcggtgcgcgagggg
cgtcggcgggaattcgccgccttcccccaattctccaccccggaaacccgcgatcgcatt
cccgatcccaatgccccggaaaccgcccgggcctgcgtgctcgactggtccgagcgcgat
cagccgacgggcgcggcggtgctggcccatcacaaacacctgctggagctgcgctttgcc
aagattgtgcccttgctgggccggctgcggccggggggcggacgctgcgagcgcatcggc
gagggcggtctggcggtgcgctgggggatcgacgacgggcgcgatctgctgatgctggcc
cagcttgccgaggccggatcattgcccggcgccccgccgcaggccgatttgatctatcgc
agcgacggcggcgagcgggccgaagcgccccttggtccgtggagcgtgcttttcgccctg
gtgccggagacgagccgatga

DBGET integrated database retrieval system