KEGG   Rhodospirillum rubrum ATCC 11170: Rru_A0506Help
Entry
Rru_A0506         CDS       T00310                                 

Definition
glycoside hydrolase
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
rru  Rhodospirillum rubrum ATCC 11170
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:rru00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
597429..599249
Genome map
AA seq 606 aa AA seqDB search
MTRRFGARVEGDGVRFSLWAPAAERVEVVIEGAAESRPVAMVPGGEGWFGAMVGGIGAGA
LYRFRIDGADLVPDPASRFQPRDVGGPSQVVDASGYAWKTDGWKGRPWAETVLYELHLGT
FSRKGTYEGARARLGDLVDLGVSAIELMPLADFVGQRNWGYDGVLPFAPDSVYGTPEQLK
ALIDAAHGLGLMVFLDVVYNHFGPEGNWLGRYAPSFFTQAHQTPWGAAIDFERPEVRDFF
VANALQWLEEYRFDGLRFDAVHAILDAEERHILGEIAVAVREALPADRHVHLVLENDANE
ARRLIGGTDVVAVRGRYDAQWNDDIHHAFHVVATGETGGYYADYAAQPLAHLGRCLAEGF
AYQGESSAHRGGMARGEPTTALPPTAFVAFLQNHDQIGNRALGERLSTLAAPDRLRALRT
ILLLGPQIPMLFMGEEWSSSRPFLFFCDFHGDLAEAVREGRRREFAAFPQFSTPETRDRI
PDPNAPETARACVLDWSERDQPTGAAVLAHHKHLLELRFAKIVPLLGRLRPGGGRCERIG
EGGLAVRWGIDDGRDLLMLAQLAEAGSLPGAPPQADLIYRSDGGERAEAPLGPWSVLFAL
VPETSR
NT seq 1821 nt NT seq  +upstreamnt  +downstreamnt
atgacaagacggtttggcgcccgggtcgagggcgatggcgtgcggttttcgctctgggcc
cccgccgccgaacgggttgaggtggttatcgaaggcgcggccgaatcgcgccccgtcgcc
atggtgcccggcggcgagggctggtttggcgccatggtcggcggcatcggcgccggggcg
ctttatcgcttccgcattgatggcgccgatctggtgcccgatccagcctcgcgcttccag
ccccgggacgtgggcggccccagtcaggtggtcgatgcgagcggctatgcctggaagacc
gacggctggaaaggccgtccctgggcggagacggtgctttacgaactgcatctgggcacc
ttcagccgtaagggaacctatgagggggcgcgggcccgcctgggggatctggtcgatctg
ggggttagcgccatcgaattgatgccgctggccgatttcgtcggtcaacgcaattggggg
tatgacggcgtgttgcccttcgcccccgacagcgtctatggcacgcccgagcagttgaag
gcgttgatcgacgccgcccacggcctggggctgatggtttttcttgatgtcgtctataat
cacttcggccccgagggcaattggctggggcgctatgcgccaagcttcttcacccaggcc
caccagaccccctggggggcggccatcgatttcgaacggcccgaggtgcgcgatttcttc
gtggccaatgctttgcaatggctggaggagtatcgcttcgacggcctgcgcttcgatgcc
gtccacgccatcctcgatgccgaggaacgccatatcctgggcgagatcgccgtggccgtc
cgcgaggccttgccggcggaccgccacgtccatctggtgctggaaaacgatgccaatgaa
gcccgccggctgatcggcggaaccgacgtggtggcggtgcgcgggcgttatgacgcccag
tggaacgatgatatccaccacgccttccatgtggtggccaccggcgagaccggcggctat
tacgccgattacgccgcccagccgctggcccatcttggtcgttgtctggccgaaggcttc
gcctatcaaggcgagtcctcggcccatcgcggcggcatggcgcgcggcgagccgacgacg
gcgctgccgccgacggccttcgtcgcctttctgcagaaccacgatcagatcggcaatcgg
gctttgggggaaagattaagcaccctggccgcgcccgaccggttgcgcgccctgcgcacg
atcttgctgctcgggccgcagatcccgatgctgttcatgggcgaggaatggtcgagctcg
cggcccttcctgttcttttgcgatttccacggcgatctggccgaggcggtgcgcgagggg
cgtcggcgggaattcgccgccttcccccaattctccaccccggaaacccgcgatcgcatt
cccgatcccaatgccccggaaaccgcccgggcctgcgtgctcgactggtccgagcgcgat
cagccgacgggcgcggcggtgctggcccatcacaaacacctgctggagctgcgctttgcc
aagattgtgcccttgctgggccggctgcggccggggggcggacgctgcgagcgcatcggc
gagggcggtctggcggtgcgctgggggatcgacgacgggcgcgatctgctgatgctggcc
cagcttgccgaggccggatcattgcccggcgccccgccgcaggccgatttgatctatcgc
agcgacggcggcgagcgggccgaagcgccccttggtccgtggagcgtgcttttcgccctg
gtgccggagacgagccgatga

DBGET integrated database retrieval system