KEGG   Rhodospirillum rubrum ATCC 11170: Rru_A0819Help
Entry
Rru_A0819         CDS       T00310                                 

Definition
asparagine synthase (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
rru  Rhodospirillum rubrum ATCC 11170
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rru00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Rru_A0819
Enzymes [BR:rru01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Rru_A0819
Peptidases [BR:rru01002]
 Cysteine Peptidases
  Family C44
   Rru_A0819
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
974936..976897
Genome map
AA seq 653 aa AA seqDB search
MTAIAGLWQDDGVVHTAERVPRMGAALAAYGPARAGISDIAAAGLALTCRQSHITDTDMI
DRQPLWDGDRRICVVADARIDNAAELALGFGWAVGEGERCSDAALILAAYRRWGPDCVGR
LTGDFAFALWDDQEQRLLLARDHYGGRPLFFAHRPGLFAFASMPKGLFALGEFSNALDAT
ELGAYVALLPQEGTRTLYRDLSRVPPGHYLLVQGERRRLVQYWPGQFREPARSGDYREHV
EEFGRLYTQAVRACLRVRPGGGIGSHLSAGFDSASVTALAARELSAQAKGLTAFTGAPRD
GFTGPYPSARVIDESGVAGEVARRFSNIEHRIIHAGPDGPLRDLERTLPYLETPFLNICN
LGWARVIEETAARSGIKVLLIGAMGNLTASFEGQIHLARLFRQGRWWQLAILARGLTREG
AGWRTVASAALGPYLPDWVRRLRHRNSPGVFAHTALSPAFAASMDMDGLAAARGSFPPRF
SDSRTARLFMIRLADPGVYHHASLAEHGIDIRDPTADRRLLDFCLTIPEGFFIRDGRRAS
LFRDAMAGLLPDTMLNRRIRGVQAADWYEKMVASRDAMAAELERLRSSPMASRVLDLDRL
CRLVADLPDPATPPEQIPAERFTSPDGAMAYRLALLRGLSMGRFIRMVEGGNG
NT seq 1962 nt NT seq  +upstreamnt  +downstreamnt
atgacggccattgccggcctctggcaggatgatggtgttgttcatacagccgagcgtgtc
ccgcgtatgggggcggctcttgccgcctacggcccggcccgggctggaatcagtgacatc
gccgcagccggtctggccctgacctgtcggcaatcccacatcaccgatacggatatgatc
gaccgccagcccctgtgggatggggatcggcgtatctgtgtggtggcggatgcccgcatc
gacaatgccgctgaactggcgcttggcttcggttgggcagtcggggagggggaacgctgt
tccgatgcggccctgatcctggccgcctaccgccgctgggggccggactgtgtgggtcgg
ctgaccggcgatttcgcctttgccctgtgggatgaccaggaacagcgtctgctgctggcc
cgggatcattatggtggccggcctctgttcttcgcccaccggcccggcctgttcgccttt
gcgtccatgccgaaggggctgttcgccctgggtgaattttccaatgccctggatgcaacc
gaactgggggcctatgtggccctgctcccgcaggaaggaacacggaccctttaccgtgac
ctgtcacgggtgccgccgggccattatctgctggttcagggcgagcggcggcggctggtg
caatattggccgggccagttcagggaaccggcccggtcgggggattaccgggagcatgtg
gaggagttcggccggctttatacccaggcggtgcgcgcctgtctgcgcgtgcggcccggt
gggggcatcggcagccatctgagcgccgggttcgacagcgcctccgtcacggccctggcc
gcccgggaactgtcggcccaggcaaaaggcctgaccgccttcacgggcgccccgcgcgac
ggtttcaccggcccttacccctccgcccgtgtgattgatgaatccggggtcgccggcgag
gtggcccgccgtttcagcaacatcgagcatcgcatcatccacgcgggtccggacggcccg
ctgcgggacctggaacggacattgccctatctggagacaccgttcctcaatatctgcaac
ctgggctgggcgcgggtcatcgaagagacggcggcccgcagcggcatcaaggttctgctg
atcggtgccatgggcaatctgacagccagtttcgagggccagattcatcttgcccggctg
ttccggcagggccgctggtggcaattggccatcctggcgcgtggtctgacgcgggaaggg
gccgggtggcgcacggtggcctcggcggcccttggcccctatctgccggattgggttcgc
cggctgcggcaccggaacagtcctggtgttttcgcccatacggccctgtccccggccttc
gcggcttccatggacatggacgggctggcggccgcccggggctctttcccccccagattc
agcgacagccggaccgcgcgcctgttcatgatacgtcttgccgacccgggcgtttaccac
catgccagcttggccgaacatggcatcgatatccgcgatccgaccgccgaccgacggctg
ctggatttctgcctgacgattcccgagggctttttcatccgggacggtcggcgcgcctcg
ctgtttcgcgacgccatggcgggtttgctgcccgataccatgctgaaccgccgcatccgg
ggtgtacaggcggcggactggtacgaaaagatggtggccagccgtgacgcgatggcggcg
gagctggagcggcttcgatcatcccccatggcgtcgcgcgttctcgatctcgaccggctg
tgccgactggtggccgatctgcccgacccggcgaccccgcccgaacagataccggcagag
cggtttacaagcccggacggcgccatggcctatcgtctggccctgctgcgtggcctgtcc
atggggcgcttcatccgcatggtggaaggcggcaacggctga

DBGET integrated database retrieval system