KEGG   Rhodospirillum rubrum ATCC 11170: Rru_A1020Help
Entry
Rru_A1020         CDS       T00310                                 

Definition
(RefSeq) cytochrome c, class I
  KO
K08738  cytochrome c
Organism
rru  Rhodospirillum rubrum ATCC 11170
Pathway
rru02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rru00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Rru_A1020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3
Motif
Other DBs
NCBI-GeneID: 3833481
NCBI-ProteinID: YP_426108
UniProt: Q2RVM4
Structure
PDB: 

Jmol
Position
complement(1209394..1209801)
Genome map
AA seq 135 aa AA seqDB search
MKKGFLAAGVFAAVAFASGAALAEGDAAAGEKVSKKCLACHTFDQGGANKVGPNLFGVFE
NTAAHKDDYAYSESYTEMKAKGLTWTEANLAAYVKDPKAFVLEKSGDPKAKSKMTFKLTK
DDEIENVIAYLKTLK
NT seq 408 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagggtttcctggccgccggcgttttcgccgccgtggctttcgcttccggcgcg
gcccttgccgagggtgatgccgccgctggcgaaaaagtcagcaagaagtgcctcgcctgc
cacactttcgatcaggggggcgccaataaggtcggccccaacctgttcggtgtgttcgag
aacacggccgcccacaaggacgactacgcctattcggaatcctacaccgagatgaaggcc
aagggcctgacctggacggaggcgaacctcgccgcctatgtcaaggatcccaaggccttc
gttcttgagaagtcgggcgatccgaaggccaagagcaagatgaccttcaagttgaccaag
gacgacgagatcgagaacgtcatcgcctacttgaagaccctgaagtag

DBGET integrated database retrieval system