KEGG   Rhodospirillum rubrum ATCC 11170: Rru_A1020Help
Entry
Rru_A1020         CDS       T00310                                 

Definition
cytochrome c, class I
Orthology
K08738  
cytochrome c
Organism
rru  Rhodospirillum rubrum ATCC 11170
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:rru00920]
Environmental Information Processing; Signal transduction; Two-component system [PATH:rru02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(1209394..1209801)
Genome map
AA seq 135 aa AA seqDB search
MKKGFLAAGVFAAVAFASGAALAEGDAAAGEKVSKKCLACHTFDQGGANKVGPNLFGVFE
NTAAHKDDYAYSESYTEMKAKGLTWTEANLAAYVKDPKAFVLEKSGDPKAKSKMTFKLTK
DDEIENVIAYLKTLK
NT seq 408 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagggtttcctggccgccggcgttttcgccgccgtggctttcgcttccggcgcg
gcccttgccgagggtgatgccgccgctggcgaaaaagtcagcaagaagtgcctcgcctgc
cacactttcgatcaggggggcgccaataaggtcggccccaacctgttcggtgtgttcgag
aacacggccgcccacaaggacgactacgcctattcggaatcctacaccgagatgaaggcc
aagggcctgacctggacggaggcgaacctcgccgcctatgtcaaggatcccaaggccttc
gttcttgagaagtcgggcgatccgaaggccaagagcaagatgaccttcaagttgaccaag
gacgacgagatcgagaacgtcatcgcctacttgaagaccctgaagtag

DBGET integrated database retrieval system