KEGG   Rhodospirillum rubrum ATCC 11170: Rru_A1088Help
Entry
Rru_A1088         CDS       T00310                                 

Definition
DNA recombination protein RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
rru  Rhodospirillum rubrum ATCC 11170
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:rru00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Rru_A1088
Enzymes [BR:rru01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Rru_A1088
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1277967..1278605
Genome map
AA seq 212 aa AA seqDB search
MIAKLKGLVDSVAEDHAVIDVGGVGYLVFCPARVLTRLPSPGQAVALVVETQVREDHISL
FGFLETAERDWFRLLSTVQGVGSKVALSVLSVLSAGQISQAIAAGDKAALGRAPGVGPKL
AARIASELKDKAVALGGMPAPPPRGAGTDAAGEGPPGGPTGDVLGDAVSALVNLGYGRSE
AVGAASRAAGLGATTVQGVIGLALRDLGRGGA
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgatcgccaagctcaagggactggtcgattcggtggccgaggatcacgcggtgatcgat
gtcggcggcgtcggctatctggtgttctgtccggcgcgggtgctaacccgcctgccgtca
cccggccaagcggtggccctggtcgttgaaacccaggtgcgcgaggatcacatctcgctt
ttcggcttcctggaaaccgccgagcgcgactggttccgtttgctctcgaccgtgcagggg
gtgggatcgaaggtggcgttgtcggtgctctcggtgctctcggccgggcagatttcccag
gcgatcgccgccggcgacaaggctgccctcggccgggcgcccggggtcggccccaagctg
gcggcgcgcatcgccagcgagttgaaggacaaggccgtcgccctgggcggaatgccggcc
ccgccgccgcgcggcgccggcaccgatgccgccggcgaggggccgccgggcgggccgacg
ggggatgtccttggcgacgcggtctcggccctggtcaatcttggctatgggcggagcgag
gcggtgggggcggccagccgggccgccggcttgggggcgaccaccgtgcaaggggtgatc
ggtctggccctgcgcgatctcggccggggaggggcataa

DBGET integrated database retrieval system