KEGG   Rhodospirillum rubrum ATCC 11170: Rru_A1203Help
Entry
Rru_A1203         CDS       T00310                                 

Definition
succinate dehydrogenase subunit D (EC:1.3.5.1)
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
rru  Rhodospirillum rubrum ATCC 11170
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:rru00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rru_A1203
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Rru_A1203
   00650 Butanoate metabolism
    Rru_A1203
  Energy metabolism
   00190 Oxidative phosphorylation
    Rru_A1203
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1420403..1420789
Genome map
AA seq 128 aa AA seqDB search
MSLRSPLGRARGLGSAKAGAANHWMAERLPAIALVPLALWFVFVAIISNLGASYAQIQAF
MAVPLNATLMLLTVFCAFFHGALGLIVIIEDYVQNHAVKNALVFGTKLYALFGAVLAAVS
ILKLTFGG
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atgtccctacgctctccgctcggccgcgcgcgcggcctgggttccgccaaggcgggtgcc
gccaatcactggatggccgagcgccttccggccatcgccttggtgccgctggcgctgtgg
ttcgttttcgtcgccatcatcagcaatctgggggcgagctacgcccagattcaggctttc
atggcggtgccgttgaacgccaccttgatgctgctgacggtgttctgcgcctttttccac
ggcgcgctcggcctgatcgtgattattgaagattacgtccaaaatcacgccgtcaagaac
gctttggtcttcggaaccaagctctacgccttgttcggtgccgttctggccgccgtctcc
atcctcaagctgactttcgggggctaa

DBGET integrated database retrieval system