KEGG   Rhodospirillum rubrum ATCC 11170: Rru_A1214Help
Entry
Rru_A1214         CDS       T00310                                 

Definition
(RefSeq) 2-oxoglutarate dehydrogenase E2 component
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
rru  Rhodospirillum rubrum ATCC 11170
Pathway
rru00020  Citrate cycle (TCA cycle)
rru00310  Lysine degradation
rru01100  Metabolic pathways
rru01110  Biosynthesis of secondary metabolites
rru01120  Microbial metabolism in diverse environments
rru01130  Biosynthesis of antibiotics
rru01200  Carbon metabolism
Module
rru_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rru_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rru00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Rru_A1214
  Amino acid metabolism
   00310 Lysine degradation
    Rru_A1214
Enzymes [BR:rru01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Rru_A1214
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H
Motif
Other DBs
NCBI-GeneID: 3833712
NCBI-ProteinID: YP_426302
UniProt: Q2RV30
Position
1434288..1435583
Genome map
AA seq 431 aa AA seqDB search
MATEIIVPQLGESVSEATVAKWFKKVGDAVAADEPLVELETDKVTVEVPAPAAGTLSEII
AAEGAEVAVGAVLALLAGAGEGAAPAKPAAAPAEKKAEPEKKPEAEKKAGPEKKAEPVAA
AAPKAASAPLDYPLPPAVRKLVDDNALDPARIPATGKDGRLTRDDVVAFLKAGAPAGAPA
SAPAPASAPAAGPAREAGPREEKVKMTRLRRRIAERLKEAQNTAAILTTFNEVDMTNLMA
LRNQYKESFEKKHGVKLGFMSFFVKACVKALQEMPAVNSEISGDSLIYKNYYDIGVAVGG
AQGLVVPVVRDCDAKSFATIEADIAGYGKKARDGSLTMEEMAGGTFTVSNGGVYGSLMST
PIINPPQSAILGMHKTMMRPMVMPDGSIAARPMMYLALSYDHRIVDGKEAVTFLVRVKEC
IEDPARLLLDA
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atggccaccgaaatcatcgtgccccaattgggcgagtccgtgtccgaagcgacggtcgcc
aagtggttcaagaaggttggcgacgccgtcgccgccgatgaaccccttgtcgagcttgag
accgataaggtcaccgtcgaggttccggccccggccgctggcacgttgagcgagatcatc
gccgcggaaggggccgaggtggcggtgggcgccgttctcgccctgctcgccggggccggg
gagggtgccgctcccgccaagcccgccgccgccccggcggagaagaaggccgagccggag
aagaagcccgaagcggaaaagaaggcggggccggaaaagaaggccgagccggtggccgcc
gccgcgcccaaggccgccagcgcccctctcgactatccgctgccgccggcggtgcgcaag
ctggtggatgacaacgcgcttgatcccgcgcgcattcccgccaccggcaaggacggccgg
ttgacccgcgacgacgtggtggccttcctcaaggccggcgctccggccggcgcgcccgcc
agcgccccggcgcccgctagcgctccggcggcgggtccggcccgcgaggccggtccgcgc
gaggaaaaggtcaagatgacccgcttgcgtcggcgcatcgccgaacgtctgaaggaggcc
cagaacaccgccgccatcctgaccacctttaacgaggtggacatgaccaatctgatggcc
ctgcgcaatcagtacaaggaaagcttcgagaagaagcatggcgtcaagctgggcttcatg
tcgttcttcgtcaaagcctgcgtcaaggccttgcaggaaatgccggcggtcaattccgag
atcagcggtgattcgctgatctacaagaactactacgatatcggcgtcgccgttggcggc
gcccagggtctggtggtgccggtggtgcgcgattgcgacgccaagtccttcgccacgatc
gaggccgatatcgccggctatggcaagaaggcccgcgatggcagcctgaccatggaagaa
atggccggcggcaccttcaccgtgtccaacggcggggtctatggctcgctgatgtcgacg
ccgatcatcaacccgccgcagtcggccattctcggcatgcataaaaccatgatgcggccg
atggtgatgcccgacggctcgatcgccgcccggccgatgatgtatctggcgctcagctac
gatcaccgcatcgttgacggcaaggaagcggtgaccttcctggtccgcgtcaaggaatgc
atcgaggatccggcccgcctgctgctcgacgcctga

DBGET integrated database retrieval system