KEGG   Rhodospirillum rubrum ATCC 11170: Rru_A1214Help
Entry
Rru_A1214         CDS       T00310                                 

Definition
2-oxoglutarate dehydrogenase E2 component (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
rru  Rhodospirillum rubrum ATCC 11170
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rru00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rru_A1214
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Rru_A1214
  Amino acid metabolism
   00310 Lysine degradation
    Rru_A1214
Enzymes [BR:rru01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Rru_A1214
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1434288..1435583
Genome map
AA seq 431 aa AA seqDB search
MATEIIVPQLGESVSEATVAKWFKKVGDAVAADEPLVELETDKVTVEVPAPAAGTLSEII
AAEGAEVAVGAVLALLAGAGEGAAPAKPAAAPAEKKAEPEKKPEAEKKAGPEKKAEPVAA
AAPKAASAPLDYPLPPAVRKLVDDNALDPARIPATGKDGRLTRDDVVAFLKAGAPAGAPA
SAPAPASAPAAGPAREAGPREEKVKMTRLRRRIAERLKEAQNTAAILTTFNEVDMTNLMA
LRNQYKESFEKKHGVKLGFMSFFVKACVKALQEMPAVNSEISGDSLIYKNYYDIGVAVGG
AQGLVVPVVRDCDAKSFATIEADIAGYGKKARDGSLTMEEMAGGTFTVSNGGVYGSLMST
PIINPPQSAILGMHKTMMRPMVMPDGSIAARPMMYLALSYDHRIVDGKEAVTFLVRVKEC
IEDPARLLLDA
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atggccaccgaaatcatcgtgccccaattgggcgagtccgtgtccgaagcgacggtcgcc
aagtggttcaagaaggttggcgacgccgtcgccgccgatgaaccccttgtcgagcttgag
accgataaggtcaccgtcgaggttccggccccggccgctggcacgttgagcgagatcatc
gccgcggaaggggccgaggtggcggtgggcgccgttctcgccctgctcgccggggccggg
gagggtgccgctcccgccaagcccgccgccgccccggcggagaagaaggccgagccggag
aagaagcccgaagcggaaaagaaggcggggccggaaaagaaggccgagccggtggccgcc
gccgcgcccaaggccgccagcgcccctctcgactatccgctgccgccggcggtgcgcaag
ctggtggatgacaacgcgcttgatcccgcgcgcattcccgccaccggcaaggacggccgg
ttgacccgcgacgacgtggtggccttcctcaaggccggcgctccggccggcgcgcccgcc
agcgccccggcgcccgctagcgctccggcggcgggtccggcccgcgaggccggtccgcgc
gaggaaaaggtcaagatgacccgcttgcgtcggcgcatcgccgaacgtctgaaggaggcc
cagaacaccgccgccatcctgaccacctttaacgaggtggacatgaccaatctgatggcc
ctgcgcaatcagtacaaggaaagcttcgagaagaagcatggcgtcaagctgggcttcatg
tcgttcttcgtcaaagcctgcgtcaaggccttgcaggaaatgccggcggtcaattccgag
atcagcggtgattcgctgatctacaagaactactacgatatcggcgtcgccgttggcggc
gcccagggtctggtggtgccggtggtgcgcgattgcgacgccaagtccttcgccacgatc
gaggccgatatcgccggctatggcaagaaggcccgcgatggcagcctgaccatggaagaa
atggccggcggcaccttcaccgtgtccaacggcggggtctatggctcgctgatgtcgacg
ccgatcatcaacccgccgcagtcggccattctcggcatgcataaaaccatgatgcggccg
atggtgatgcccgacggctcgatcgccgcccggccgatgatgtatctggcgctcagctac
gatcaccgcatcgttgacggcaaggaagcggtgaccttcctggtccgcgtcaaggaatgc
atcgaggatccggcccgcctgctgctcgacgcctga

DBGET integrated database retrieval system