KEGG   Rhodospirillum rubrum ATCC 11170: Rru_A1239Help
Entry
Rru_A1239         CDS       T00310                                 

Definition
gamma-glutamyl kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
rru  Rhodospirillum rubrum ATCC 11170
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:rru00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Rru_A1239
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Rru_A1239
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    Rru_A1239
Enzymes [BR:rru01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Rru_A1239
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1461951..1463078)
Genome map
AA seq 375 aa AA seqDB search
MIKIGSALLVDQGSGLVRTGWLKALAEDIAQLRAEGREVLIVSSGAIAVGRRSLHLEPGR
MRLDEKQAAAAAGQIELAHAYRTVMADHAINVAQLLLTLDDSENRRRYLNARNCLETLLR
LGVIPVINENDTVTTQEIRFGDNDRLAARVAQMACADALILLSDIDGLYTADPHRDPEAR
FIPTVTALTPEIAAMAGAALTPHGTGGMVTKLLAARICMDAGCAMAIAPGKDDHALRLLR
QGGRQTWFLPAEEPRTARKAWISGALKAEGTLWVDDGAARALAAGSSLLPPGVRTVEGDF
QRGAAVRVVGLDGSPLAKGLIAYPSDEARLLVGHRSGDIEALLGYRGREELIHRDDLVLD
SRFRHRDEDGEGHRS
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
gtgatcaagatcggctcggcccttctcgtcgatcagggcagcgggctggtgcgcaccggc
tggctcaaggccctggccgaagacatcgcccagctgcgcgccgaagggcgcgaggtgctg
atcgtctcctcgggggcgatcgccgtcggccggcgctcgctgcatctggaaccgggccgc
atgcggcttgatgaaaagcaggccgccgccgccgccggccagatcgaactggcccatgcc
tatcgcacggtgatggccgatcacgccatcaacgtcgcccaattgctgctgacccttgat
gactccgagaaccgccggcgttatctcaacgcccgcaactgcctggaaaccctgctccgg
ctaggcgtcatcccggtcatcaacgaaaacgacaccgtcaccacccaggaaatccgcttt
ggcgacaacgaccggctggccgcccgcgtcgcccagatggcctgcgccgacgcgttgatc
ctgctttcggatatcgatggcctttataccgccgatccccaccgcgatcccgaggcccgc
ttcatccccaccgtcaccgccctgaccccggagatcgccgccatggccggggcggcgctg
accccgcatggcaccggcggcatggtcaccaagcttctggccgcgcgcatctgcatggat
gccggctgcgccatggcgatcgccccgggcaaggacgaccacgccttgcgcctgctgcgc
cagggcggccgccagacctggttcctgccggccgaagagccgcgcacggcgcgcaaggca
tggatttccggggcgctgaaggccgaggggaccctgtgggtcgatgacggcgccgcccgg
gcgctggcggcgggcagcagcctgttgccgccgggcgtgcgcacggtcgagggcgatttc
cagcgcggcgccgccgtgcgggtggtcgggctcgacggcagcccgctggccaaggggctg
atcgcctatccctccgacgaggcgcgtttgctcgtcggccatcgcagcggcgacatcgag
gcgctgctgggataccgtgggcgcgaggaactgatccaccgcgatgatctggtgctcgac
agccgcttccggcaccgcgacgaggacggggaaggacaccgatcgtga

DBGET integrated database retrieval system