KEGG   Rhodospirillum rubrum ATCC 11170: Rru_A1289Help
Entry
Rru_A1289         CDS       T00310                                 

Definition
alkaline phosphatase (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
rru  Rhodospirillum rubrum ATCC 11170
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:rru00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Rru_A1289
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Rru_A1289
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Rru_A1289
Enzymes [BR:rru01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Rru_A1289
Exosome [BR:rru04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Rru_A1289
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1522107..1523849
Genome map
AA seq 580 aa AA seqDB search
MRTLCATLMLTTCLGTAAQAATVYPLDRATILAGSPFDLKVEFDGAVKAADVTVTINGQP
AAKVLGKDVQFVEKEAGTEASAVLIRAATLAKPGSYTLTASAGADTKSVTWDVYGTPATA
KAKNVIFFLGDGLSVAHRTGARLMSKGMTEGKANGRLNMDDLDHMAFIGTSATNAVATDS
ANTMSAYMTGHKTAVNALGVYADRTEDSLDDPRVETIAEALRRTTTKSIGVVAMSELEDA
TPAAVFAHTRKRADKAKITEMIFDLKPDVLLGGGSAFFLPKSVPGSKRKDDKDYVAAFKD
AGYTVATSASELEAAKGTNSGKILGLFHTGNMDTYLDRVQLKKGTVGKFPDQPGLVEMTT
VALGQLAKNPDGFFLMVEGSSIDKMAHPMDWERSMVETIEFDQAIGVAREFVKTHPDTLI
VVTGDHTHGVSIIGTIDDNKPGAEMRDKVGTYADAGFPNYTDENKDGYPDRVDVSRRLAI
FSSNFPDYYETFQPKLDGPFVPAIQNEKKEYVANEAYKSVPGAVLRIGNLPRSEDTAVHA
VDDVVLQATGPGAEGFKGYMEESDVYRVLAETLALAPAKK
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atgcggaccctttgcgcgaccttgatgctcaccacctgcctgggcaccgccgcccaggcc
gccaccgtctatccgctcgatcgggcgacgatcctcgccggctcgcccttcgatctgaaa
gtcgagttcgacggggccgtcaaagccgccgacgtgacggtgaccatcaatggtcagccc
gccgccaaggtgttgggcaaggacgttcagttcgtcgaaaaggaagcgggcaccgaggcc
tcggccgtactgatccgcgccgccaccctggccaagccgggctcctataccctgaccgcc
agcgccggggcggacaccaaaagcgtcacctgggatgtttacggcacgccggcgacggcc
aaggccaagaacgtcatcttcttcctgggcgacggcctgtcggtggcccaccgcaccggc
gcccgcctgatgtccaagggcatgaccgagggcaaggccaacggccgcctgaacatggac
gacctcgaccatatggccttcatcggcacctcggcgaccaatgccgtcgccaccgatagc
gccaataccatgtcggcctatatgaccggccacaagacggcggtgaacgcccttggcgtc
tatgccgaccgcaccgaggacagcctggacgatccccgcgtcgagaccattgccgaggcc
ctgcgccgcaccaccacgaagtcgatcggcgtcgtggcgatgtccgagcttgaagacgcc
accccggccgccgttttcgcccatacccgcaagcgggccgataaggccaagatcaccgag
atgatcttcgatctgaaacccgacgtgctgctcggcggcggctcggccttcttcctgccc
aaaagcgtccccggttccaagcgcaaggacgacaaggactatgtcgccgcgttcaaggac
gcgggctataccgtggcgacctcggccagcgaactggaagccgccaagggcaccaatagc
ggcaagatcctgggccttttccacaccggcaatatggatacctatctcgatcgcgtgcag
ttgaagaagggcaccgtcggcaagttccccgaccagcccggtctggtcgagatgaccacc
gtcgccctgggccagcttgccaagaacccggacggcttcttcctgatggtcgaaggctcg
tcgatcgacaagatggcccatccgatggattgggaacgctcgatggtcgagaccatcgaa
ttcgatcaggcgatcggcgtcgcccgcgagttcgtcaaaacccatcccgatacgctgatc
gtcgtcaccggcgaccatacccacggcgtgtcgatcatcggcaccatcgacgataacaag
cccggtgccgagatgcgcgacaaggtcggcacctatgccgatgccggtttccccaattac
accgacgaaaacaaggacggctatcccgaccgcgtcgatgtctcgcgccgtctggcgatc
ttctcgagcaatttccccgattactacgaaaccttccagcccaagctcgatggccccttc
gttcccgccattcagaacgagaagaaggaatacgtcgccaacgaggcctataagtcggtt
cccggcgccgtgttgcgcatcggcaatctgccgcgcagcgaagacaccgccgtccatgcc
gtcgacgatgtcgttctccaggccaccggccccggcgccgagggcttcaagggctatatg
gaggaaagcgacgtctatcgcgtgctggccgaaaccctggcgctcgctccggcgaaaaag
taa

DBGET integrated database retrieval system