KEGG   Rhodospirillum rubrum ATCC 11170: Rru_A1358Help
Entry
Rru_A1358         CDS       T00310                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
rru  Rhodospirillum rubrum ATCC 11170
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:rru00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rru_A1358 (tpiA)
   01230 Biosynthesis of amino acids
    Rru_A1358 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rru_A1358 (tpiA)
   00051 Fructose and mannose metabolism
    Rru_A1358 (tpiA)
   00562 Inositol phosphate metabolism
    Rru_A1358 (tpiA)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Rru_A1358 (tpiA)
Enzymes [BR:rru01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Rru_A1358 (tpiA)
Exosome [BR:rru04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Rru_A1358 (tpiA)
  Exosomal proteins of bladder cancer cells
   Rru_A1358 (tpiA)
  Exosomal proteins of melanoma cells
   Rru_A1358 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1599769..1600545)
Genome map
AA seq 258 aa AA seqDB search
MNARLWIGTSWKMHKTIAEAEAYVGELTASPLLDRVEAFIVPPFTALAAVHRALGDAPVH
LGAQTMHWQDEGAQTGEISPLMLRDCGVGIVELGHSERRASHGETDATVNAKVASALRHG
LRPLICVGDQGDDLDAGASIETVLRQVKLAIKGIDTASLGRALIAYEPVWAIGEAGRPAE
PAHVAEVHGALRAMLGQRGLAALPLLYGGSVDRANAGALTALANVDGLFVGRAAWTARGF
EEVIEAALHGAKDRAGLA
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcccgattgtggatcggaacaagctggaagatgcacaagaccatcgccgaggcc
gaggcctatgtcggcgaactgaccgcctcgccgctgctcgaccgggtcgaggcgttcatc
gtgccgcccttcaccgccctggccgccgtccaccgggctttgggcgacgccccggtccac
ctgggcgcccagaccatgcattggcaagacgagggggcgcagaccggcgagatttccccg
ctgatgctgcgcgattgcggcgtcggtatcgtcgaactcggccattccgagcgccgcgcc
agccatggggaaaccgacgccaccgtcaacgccaaggtggccagcgccctgcgccacggt
ttgcggccgctgatctgcgttggcgaccagggcgacgacctggacgccggagcctcgatc
gaaacggtcctgcgccaagtcaagctggccatcaaaggcatcgacacggccagcctgggc
cgggcgctcatcgcctatgaaccggtctgggcgatcggcgaagccgggcgaccggccgaa
ccggcgcatgtggccgaggttcatggcgccctgcgcgccatgctcggccaacggggcttg
gctgccctgcccctgctttatggcggcagcgtcgatcgcgccaatgccggggctctcacc
gccctagccaacgttgacggcctgttcgtcggccgcgccgcctggacggcgcgcggcttc
gaagaggtgatcgaggccgctttgcacggggccaaggaccgggcgggtcttgcgtaa

DBGET integrated database retrieval system