KEGG   Rhodospirillum rubrum ATCC 11170: Rru_A1358Help
Entry
Rru_A1358         CDS       T00310                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
rru  Rhodospirillum rubrum ATCC 11170
Pathway
rru00010  Glycolysis / Gluconeogenesis
rru00051  Fructose and mannose metabolism
rru00562  Inositol phosphate metabolism
rru00710  Carbon fixation in photosynthetic organisms
rru01100  Metabolic pathways
rru01110  Biosynthesis of secondary metabolites
rru01120  Microbial metabolism in diverse environments
rru01130  Biosynthesis of antibiotics
rru01200  Carbon metabolism
rru01230  Biosynthesis of amino acids
Module
rru_M00002  Glycolysis, core module involving three-carbon compounds
rru_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:rru00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rru_A1358 (tpiA)
   00051 Fructose and mannose metabolism
    Rru_A1358 (tpiA)
   00562 Inositol phosphate metabolism
    Rru_A1358 (tpiA)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Rru_A1358 (tpiA)
Enzymes [BR:rru01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Rru_A1358 (tpiA)
Exosome [BR:rru04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Rru_A1358 (tpiA)
  Exosomal proteins of bladder cancer cells
   Rru_A1358 (tpiA)
  Exosomal proteins of melanoma cells
   Rru_A1358 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM XdhC_CoxI
Motif
Other DBs
NCBI-GeneID: 3834773
NCBI-ProteinID: YP_426446
UniProt: Q2RUN6
Position
complement(1599769..1600545)
Genome map
AA seq 258 aa AA seqDB search
MNARLWIGTSWKMHKTIAEAEAYVGELTASPLLDRVEAFIVPPFTALAAVHRALGDAPVH
LGAQTMHWQDEGAQTGEISPLMLRDCGVGIVELGHSERRASHGETDATVNAKVASALRHG
LRPLICVGDQGDDLDAGASIETVLRQVKLAIKGIDTASLGRALIAYEPVWAIGEAGRPAE
PAHVAEVHGALRAMLGQRGLAALPLLYGGSVDRANAGALTALANVDGLFVGRAAWTARGF
EEVIEAALHGAKDRAGLA
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcccgattgtggatcggaacaagctggaagatgcacaagaccatcgccgaggcc
gaggcctatgtcggcgaactgaccgcctcgccgctgctcgaccgggtcgaggcgttcatc
gtgccgcccttcaccgccctggccgccgtccaccgggctttgggcgacgccccggtccac
ctgggcgcccagaccatgcattggcaagacgagggggcgcagaccggcgagatttccccg
ctgatgctgcgcgattgcggcgtcggtatcgtcgaactcggccattccgagcgccgcgcc
agccatggggaaaccgacgccaccgtcaacgccaaggtggccagcgccctgcgccacggt
ttgcggccgctgatctgcgttggcgaccagggcgacgacctggacgccggagcctcgatc
gaaacggtcctgcgccaagtcaagctggccatcaaaggcatcgacacggccagcctgggc
cgggcgctcatcgcctatgaaccggtctgggcgatcggcgaagccgggcgaccggccgaa
ccggcgcatgtggccgaggttcatggcgccctgcgcgccatgctcggccaacggggcttg
gctgccctgcccctgctttatggcggcagcgtcgatcgcgccaatgccggggctctcacc
gccctagccaacgttgacggcctgttcgtcggccgcgccgcctggacggcgcgcggcttc
gaagaggtgatcgaggccgctttgcacggggccaaggaccgggcgggtcttgcgtaa

DBGET integrated database retrieval system