KEGG   Rhodospirillum rubrum ATCC 11170: Rru_A1394Help
Entry
Rru_A1394         CDS       T00310                                 

Definition
(RefSeq) nitrogenase iron-iron protein, alpha chain
  KO
K02586  
nitrogenase molybdenum-iron protein alpha chain [EC:1.18.6.1]
Organism
rru  Rhodospirillum rubrum ATCC 11170
Pathway
Chloroalkane and chloroalkene degradation
Nitrogen metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Module
Nitrogen fixation, nitrogen => ammonia
Brite
KEGG Orthology (KO) [BR:rru00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    Rru_A1394
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Rru_A1394
Enzymes [BR:rru01000]
 1. Oxidoreductases
  1.18  Acting on iron-sulfur proteins as donors
   1.18.6  With dinitrogen as acceptor
    1.18.6.1  nitrogenase
     Rru_A1394
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
complement(1645052..1646611)
Genome map
AA seq 519 aa AA seqDB search
MPHHTFKCSECIPERTKHAVIKGADEDLTSCLPLGYLNTIPGSISERGCAYCGAKHVIGQ
PMKDVIHISHGPIGCTYDTWQTKRYISDNNNFQLKYTYATDVREKHIVFGAEKLLKQNIL
EAFKAFPDIKRMTIYQTCATALIGDDIDAIASEVMDELPDVDIFVCNSPGFAGPSQSGGH
HKINIAWVNQKVGTVEPEITSDYVINYVGEYNIQGDQEVMQDYFNRMGIQILSTFTGNGS
YDGLRAMHRAHLNVLECARSAEYICNELRVRYGIPRLDIDGFGFEPLSDSLRKIGLFFGI
EDRAQAIIDEETAKWKPQLDWYKERLRGKKVCLWPGGSKLWHWAHVIQEEMGLNVVSLYT
KFGHQGDMEKGIARCGEGALAIDDPNELEGLEALEMLKPDIILTGKRPGEVAKKVRVPYL
NAHAYHNGPYKGYEGWVRFARDIYNAIYSPIFQLSALDISKDPIPTDQGFLTPQMISDPA
LPAEVRSSTVLTPYRGAYDTISALREKTYPRFDAVPVAQ
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgccccaccataccttcaaatgcagcgaatgcatccccgagcgcaccaagcacgcggtg
atcaagggcgccgacgaggacctgacctcgtgcctgccgctgggttatctcaataccatt
ccgggatcgatctccgagcgcggctgcgcctattgcggcgccaagcacgtgatcggccag
ccgatgaaggacgtcatccatatcagtcacggaccgatcggatgcacctacgacacctgg
cagaccaagcgttatatcagcgataacaacaacttccagctcaagtacacctatgccacc
gatgttcgggaaaagcacatcgtctttggcgccgagaagcttctcaagcagaacatcctc
gaagccttcaaggcgtttcccgacatcaagcgcatgaccatctaccagacctgcgccacg
gcgctgatcggcgatgacatcgacgccatcgcctcggaagtgatggacgagttgcccgat
gtcgacatcttcgtctgcaactcgccgggcttcgccgggcccagccagtcgggcggccac
cacaagatcaatatcgcctgggtcaaccagaaggtcggcaccgtcgagcccgagatcacc
agcgattacgtcatcaactatgttggtgagtataatatccagggcgatcaggaagttatg
caggattacttcaatcgcatgggcatccagatcctgtcgaccttcaccggcaacggatcc
tatgacggcctgcgggcgatgcaccgcgcccatctcaatgtgctcgaatgcgcccgttcg
gccgaatacatctgcaatgaattgcgcgtgcgctatggcatcccgcgccttgatatcgac
ggcttcggcttcgaaccgctgtcggactcgctgcgcaagatcggcctgttcttcggcatc
gaagaccgcgcccaggcgatcatcgacgaagaaaccgccaagtggaaaccccagcttgat
tggtacaaggaacgcctgcgcggcaagaaggtctgcctgtggccgggcggctccaagctt
tggcattgggcccatgtcatccaggaggaaatgggcctcaacgtcgtgtcgctctacacc
aaattcggccatcagggcgatatggaaaagggcatcgcgcgctgcggcgaaggcgccctg
gccatcgacgatcccaacgagcttgaaggcctggaagccctggagatgctcaagcccgac
atcatcttgacgggcaagcgcccgggcgaggtcgccaagaaagtgcgcgttccctatctc
aacgcccacgcctatcacaacggcccctataagggctacgagggctgggtgcgcttcgcc
cgcgatatctacaacgccatctattcgccgatcttccagctgtcggccctcgatatcagc
aaggacccgatcccgaccgaccagggcttcctgacgccgcagatgatctccgatccggcc
ctgcccgccgaggtgcggtcttcgaccgtgctgaccccctatcgcggcgcttacgacacc
atttccgccctgcgcgagaagacctatccgcgcttcgatgccgttcctgtcgcccaataa

DBGET integrated database retrieval system