KEGG   Rhodospirillum rubrum ATCC 11170: Rru_A1406Help
Entry
Rru_A1406         CDS       T00310                                 

Definition
two component CheB methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
rru  Rhodospirillum rubrum ATCC 11170
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:rru02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:rru02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1660519..1661610
Genome map
AA seq 363 aa AA seqDB search
MPRKIRVLIVDDSASVRQTMTEILESDPGIEVIGTAPDPYVAARRIQQEVPDVITLDVEM
PRMDGITFLRKIMAQRPIPVVVCSSLTETDSETASQAWEAGAVEIILKPRVGTAQFLLES
KIHICDVVKAAAGARLRSMPAAGRANRPRVPEKKLTADAVLPPPVAGRNAMARTTESVIC
IGASTGGTESLREVLEALPAASPAIVIVQHMPEKFTEAFARRLDSLCDMEVKEAVDGDTV
MRGRVLIAPGNHHMLLQRSGARYYVSVKDGPLVSRHRPSVDVLFRSAASHAGSNAVGIIM
TGMGDDGARGLLEMRKAGAYTIAQDEATSVVFGMPKEAIALGAADKILPLEMLAMEILRA
GNR
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgccccgcaaaatccgtgtcctgattgtcgatgattccgcctccgttcgccagacgatg
accgagatcctggaatccgatccggggatcgaggtgatcggcaccgcgcccgacccttat
gtcgccgcccggcgcatccagcaggaagtgcccgatgtcatcacccttgatgtcgagatg
ccgcgcatggacggcatcacctttctgcgcaagatcatggcccagcggccgattccggtg
gtcgtgtgctcctcgttgaccgaaacggattcggaaaccgcctcgcaggcctgggaggcc
ggggcggtcgagatcattctcaagccccgcgtcggcaccgcccagttccttctggaatcg
aaaatccatatctgcgacgtggtcaaggccgccgccggcgcccgtctgcgctccatgccc
gctgcggggcgcgccaaccggccaagggtgcccgaaaagaagctgaccgccgacgccgtt
ctgccgccgccggtggccgggcgcaacgccatggccagaaccacggaatcggtcatctgc
atcggcgcctcgaccggcggcaccgaatccctgcgcgaggtgctggaagccctgccggcg
gccagcccggccatcgtcatcgtccagcacatgcccgagaaattcaccgaggcgttcgcc
cgccgcctcgatagcctgtgtgacatggaggtcaaggaggccgtcgatggcgatacggtg
atgcgcggccgggtgctgatcgcgccgggcaaccaccacatgttgctccagcgcagcgga
gcgcggtactatgtctcggtcaaggatggtcccttggtctcgcgtcaccgtccttcggtc
gatgtgttgttccgctcggcggccagtcacgccggttcgaacgccgtgggcatcatcatg
accggcatgggtgacgatggggcgcgcggattgctcgagatgcgaaaggccggcgcctat
accatcgcccaggacgaagccacctcggtggttttcggcatgccgaaggaagcgatcgcc
ctgggggcggccgacaagatcctgccgctcgagatgctggcgatggaaattctgcgcgcc
ggtaaccgatga

DBGET integrated database retrieval system