KEGG   Rhodospirillum rubrum ATCC 11170: Rru_A1500Help
Entry
Rru_A1500         CDS       T00310                                 

Definition
signal transduction histidine kinase with CheB and CheR activity (EC:2.1.1.80 3.1.1.61)
Orthology
K13924  
two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
rru  Rhodospirillum rubrum ATCC 11170
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:rru00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Rru_A1500
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Rru_A1500
Enzymes [BR:rru01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.80  protein-glutamate O-methyltransferase
     Rru_A1500
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Rru_A1500
Two-component system [BR:rru02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Rru_A1500
Bacterial motility proteins [BR:rru02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Rru_A1500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1771039..1775490
Genome map
AA seq 1483 aa AA seqDB search
MPRRSFPWAGAVRSRAEEGVSPTDGASEGKGGSGEADRFRVVGIGASAGGLEACKALLAA
LPDRPGIALILVQHLDPTHESMMVALLALQTTMTVCQAAEGMIVEPDHLYVIPPGAYLSV
AGGTLHLSPPQARHGARLPFDFLLHSLAADYTQRAICVVLSGTGADGSLGLMALKERGGL
VIAQDPEEAGYDGMPRSAIATGQVDLVLSLAKIAETLVGEDLPPGKPALPEEIPSSKGKG
KGKGWVYAVIDLLRARTPYDFTHYKPGTLERRTERRMTLASIEVGDSARYLALLQEDATE
RDLLAKDLLINVTGFFRDPKVFDVLAEKTIPQMVATHPLDQPLRIWVAGCSTGEETYSLA
ILFREAIVSAGRAVKVQVFASDVDPDAVLSAREGRYPSTIEADVSAERLARFFTRDGDDY
RILPDLRSMVVFTVQDLLADPPFSRLDMVSCRNLLIYLRPEAQAKAIGLFHFALREGGIL
LLGNSETAGNVEGRFEVLSKSARLYRRIGRGGRVDLRLPVVGGDGSGAQRRPLFEPARSR
QATLADLCRRLVVEAYAPAAVLITLKYDCLYFLGAMDSYLRVAAGHPASDLLSLAREEVR
TKLRSAIEMACETKTRTLVTGGRLTHGGTVRGFSIAVHPVSHDGEDLLLVCFLDEVPSER
RADTPTSAEHAPRVAELEQELEITRSELRGAIRNLEISSEEQKAINEEALSVSEEYQATN
EELLASKEELQSLNEELTALNGQLHETLERQRTTSNDLQNVLYSTDVATLFLDTALNIRF
FTPATKLLFRVIPGDIGRPLADLSPLVADDALLGDAAKVLKTMTPIEREIEARSGSWYLR
RILPYRTQDNGVEGVVITFADITERRWAADAREVAKRQAQIANMAKSRFLAVASHDLRQP
LQTLTLLQGLLAKKVEGVQSRVLLARMDETLGAMSSMLNVLLDINQIEVGTVEAERVVFP
INDLFDRVREELAYQARAKKLDWSVVSCGLSVTSDPRLLEQMIRNLLANALKYTKQGKVL
LGCRRRSGSLSIEVWDSGIGIPPGELEAIFDEFHQVETPAQGQGRGLGLGLSIVRRLGDL
LGHPIGVRSRLGKGSVFTINVAIAPAAAEKPSLPARRGAAEVKVDADGQRTGEILIIEDD
PDVRDLLDLLLKGEGHRTVAVAEGGQAVALAEGGSIRPDLILADYNLPNGVNGLGVSATL
RDVLDRPIPVVILTGDISTRTLHDIARHRCVKLNKPVKPGELTQTIARLLPPPVGPAAAR
LPAPPPSPGPGGPLPLIYLVDDDASLRDSLRALLEDDGLKVEDYESSEAFLAAYRPGGGE
ACLLIDAYLPGMSGLDLLERLKKENRLLPAIVITGYSEVAMAVQAMKAGASDFIEKPVGR
TELLISIDRALEQHREHGNSGKMRLWRDAAKARLASLSARQREIMEMVLAGQPSKNIAAD
LGISQRTVESHRALIMKKLGVKSLPALVRLAQAASDGEVGEEG
NT seq 4452 nt NT seq  +upstreamnt  +downstreamnt
atgccaagacggtcattcccttgggccggagcagtccggtctcgtgccgaggaaggcgtc
tcgccgacagacggagcttccgaaggaaagggcggctcaggggaggcggaccgcttccgg
gttgtcggcatcggcgcttcggcgggggggctggaagcctgcaaggctttgctcgcggcc
ttgcccgatcgtcccggcatcgccctgatcctggtccaacatcttgatcccacccatgaa
agcatgatggtggccttgctcgccctgcaaaccaccatgacggtttgccaggcggccgaa
ggcatgatcgttgagcccgatcacctttatgtcatcccgcccggcgcctatctttccgtt
gccgggggaaccctgcacctctcgccaccccaggcccgccatggcgcccgcctgccgttc
gatttcctgctgcattcgctggctgcggattatacgcagagggctatctgcgtggttctt
tcgggaaccggggcggatggcagtctgggattgatggcgttgaaagagcgcggcgggctg
gtgatcgcccaggatcccgaagaggccgggtatgatggcatgccgcgcagcgccatcgcc
accggacaggtcgatctggtgctgagcctcgccaagatcgccgaaaccctggtcggcgag
gacctgccccccggtaagcccgcccttcccgaggagatcccgtcgagcaagggcaaaggc
aaaggcaaaggctgggtttacgcggtgatcgatctgctgcgcgcccgaaccccctatgac
ttcacccattacaagccgggcaccctggaacggcggaccgaacggcgcatgacgttggcc
tcgatcgaggtcggcgactcggcgcgctatttggcgcttctccaggaggatgccaccgag
cgcgatcttcttgccaaggacctgctgatcaacgtcaccggttttttccgcgatcccaag
gtcttcgatgtcctggccgaaaagaccattccccagatggtcgccacccatccccttgat
cagcccctgcgcatttgggtcgcgggctgtagcacgggcgaggaaacctattccctggcc
atactgttccgcgaggcgatcgtcagcgccgggcgggcggtcaaggtgcaggtcttcgcc
tccgatgtcgatcccgacgccgtcctcagcgcccgcgaaggccgttatcccagcaccatc
gaagccgatgtctcggccgaacggctcgcccgcttcttcaccagggacggcgatgattac
cgtattctgcccgacctgcgctccatggtggttttcaccgttcaggatttgctggccgat
ccgccgttttcgcggctggatatggtgtcgtgccgcaatctgctgatctatctgcgcccc
gaagcccaggccaaggcgatcggcctgttccatttcgccctgcgcgagggcggcattctg
ttgctgggcaattccgagacggcgggcaatgtcgaaggccgcttcgaggttttgtccaaa
tcggcgcggctctatcggcggatcggtcgcggcggccgggtcgatttgcgtttgccggtg
gtcgggggcgatgggagcggggcccagcgccggcccctgttcgagccggcgcggtcgcgt
caggccacccttgccgatctctgccggcggcttgtcgtcgaggcctacgccccggcggcg
gtgttgatcaccctgaaatacgactgtctttatttcctgggggcgatggacagctatctg
cgggtggcggcgggccatccggcctccgatctgctcagtctggcccgcgaggaggtgcgg
accaagctgcgctcggccatcgagatggcgtgcgaaacgaaaacacgaaccctggtcacc
ggcggccggcttacccatggcggcaccgtgcggggcttcagcatcgccgttcatcccgtc
tcccacgatggggaagacctgctgctggtctgtttccttgacgaagtgccgtccgaacga
cgggccgatacgccgacttcggccgagcacgcgccgcgggtggccgaactggagcaagag
cttgaaatcacgcgaagcgaactgaggggcgccattcgcaatcttgagatttcaagcgaa
gaacaaaaggcgatcaacgaagaggccttgtcggtcagcgaggaatatcaggcgacgaac
gaggaactgctggcctccaaagaggaattgcagtcgctgaacgaggaactgaccgcgctg
aacggccagcttcatgaaacgctcgaacgccaaagaacaacctccaacgatctgcagaac
gttctctacagtacggatgtcgcgacgctttttctcgataccgcgctgaatatccgcttt
ttcaccccggcgacgaagctgctgttcagggtgatccccggcgatatcggccgaccgctg
gccgatctcagtcctttggtcgccgacgacgccctgctgggcgatgccgccaaggtgctg
aaaaccatgacgccgatcgagcgcgagatcgaggcgcgcagcgggtcgtggtatcttcgc
cggatcctgccctatcgcacccaggacaacggggtcgagggggtggtcatcacctttgcc
gatatcaccgaacgccgctgggcggccgatgcccgcgaggtggccaaacgccaagcccag
atcgccaatatggcgaaatcgcgctttctggcggtggcgagccatgacctgcgtcaaccg
ctccaaaccctgaccctgctccaggggcttctggccaagaaggtcgaaggggtgcagtcg
cgcgttctgctcgcccgcatggacgagaccctgggcgccatgtcgtcgatgctcaatgtc
ctgctcgatatcaaccagatcgaggttggaaccgtcgaggccgagagggtggttttcccc
atcaatgatctgttcgatcgggtgagggaggaactggcctatcaggcccgagccaagaag
cttgactggagcgtggtttcttgcggcttgtcggtgaccagcgatccgcgtctgcttgaa
cagatgatccgcaatctgctcgctaatgccctgaaatacaccaaacagggcaaagttctt
ttgggctgtcgccggcggtcgggctctttgagcatcgaggtctgggatagcggcatcggt
attcccccaggcgagctcgaggcgattttcgacgagtttcatcaggtcgagaccccggcg
caaggacaagggcgcggcctgggccttggcctgtcgatcgtgcgccgccttggcgatctg
cttggccatcccatcggcgtgcgctcgcggcttggcaagggctcggtcttcaccatcaat
gtggcgatcgccccggccgccgccgagaagccttcgcttccggcgcgacggggcgcggcc
gaggtcaaagtcgacgccgacggtcagcggaccggggaaatcctgatcatcgaggacgat
cccgacgttcgcgatcttcttgatcttctgctcaagggcgaggggcaccggacggtcgcc
gtggccgagggggggcaggcggtggccctggccgaaggcggcagcatccggcccgatctg
atcctggccgattataatctgccaaacggcgtcaatggcctgggcgtcagcgccaccctg
cgcgacgttctcgatcggcccattcccgtggtcatcctgaccggtgacatttcgacccga
accctgcacgatatcgcccgtcatcgctgcgtgaagctcaataaaccggtgaaacccggg
gaactgacccagaccatcgcccgcctgctgcccccgccggtggggccggcggcggcgcgg
ctgccagccccgccgccgtcgccaggccccggtggtccgttgcccttgatctatctggtc
gacgatgacgcgtctttgcgcgacagcctgcgcgccctgctggaagacgacggcctgaaa
gtggaagactacgaaagctccgaagccttccttgccgcctatcgcccgggcggcggcgaa
gcctgcctgctgatcgatgcctatcttcccggaatgagcgggcttgacctgcttgaacgg
cttaaaaaagaaaaccgccttttgcccgcgatcgtcatcaccggctatagcgaggtggcg
atggcggtgcaggcgatgaaggcgggcgcttcggatttcatcgaaaagccggtcggtcga
accgaattgttgatcagcatcgaccgcgccctggaacagcatcgcgagcatggcaacagc
ggcaagatgcggctttggcgcgatgccgccaaagcccgcctcgccagtctgagcgcgcgc
cagcgcgaaatcatggagatggtccttgccgggcaaccgagcaagaacatcgccgccgat
ctggggatcagccaaagaaccgtggaaagccatcgcgccctgatcatgaagaaacttggc
gtgaaatccctgccggccttggtccgtctggcccaggccgccagcgacggtgaggtcggc
gaagaggggtaa

DBGET integrated database retrieval system