KEGG   Rhodospirillum rubrum ATCC 11170: Rru_A1548Help
Entry
Rru_A1548         CDS       T00310                                 

Definition
malonyl-CoA decarboxylase (EC:4.1.1.9)
Orthology
K01578  
malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
rru  Rhodospirillum rubrum ATCC 11170
Pathway
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rru00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Rru_A1548
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Rru_A1548
Enzymes [BR:rru01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.9  malonyl-CoA decarboxylase
     Rru_A1548
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1824302..1825738
Genome map
AA seq 478 aa AA seqDB search
MTDPLSANPGFFLRLSALWRDIAGGRGTGAMPPLSPGLDDDDMGVVRQQLNACLEGKGGV
VSAHARAASLGRAYLSLNEEGRIRFLGILAREFSTDHQAVIAAARALIEASSGGDTGAIL
AAETELGRTLTAPRRILLTQFNALPEGVKFLVDLRGELLTHIKTHPELRPLERDLRDLLT
AWFDVGFLDLERITWESSASFLEKIITYEAVHAIQSWDDLKNRLDHDRRLYAFVHPRMPH
EPLIFVEVALVNGISGTIGDLLDLEAPLLDPAQADTAIFYSISNAQSGLAGISFGNFLIK
RVVETLRREFPGLKTFSTLSPIPGFRRWLDGVFAEGDIGPMSSAERKALRAVDDRGAKGA
LKRLIETDGWLTEEGGEEAVKGPLMRLRARYLAVERRLGSGEGVERAYDPVAHFHLTNGA
RVERINWRGDLSANGLRQSMGMMVNYLYKLDEIEKNHEAYQGNAVAAVSGTVKTLLKA
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatccgctttccgccaatccggggttcttcctgcggctttccgccctgtggcgc
gacatcgccggcggtcgtggcacgggggcgatgccgccgctgtcaccggggttggacgac
gatgacatgggcgttgtccgccaacagttgaacgcctgcctggagggcaagggcggcgtg
gtgtccgcccatgcccgcgccgcctcgctggggcgggcctatctcagcttgaacgaggag
gggcgcatccgctttcttggcattctcgcccgcgagttctcgaccgaccatcaggcggtg
atcgccgccgcccgcgccctgatcgaggcctcgtcgggcggcgacacgggcgccatcctg
gcggccgagaccgagctggggcggacgctgacggcgcccaggcgcattcttctcacccag
ttcaacgccttgcccgaaggggtgaagtttctggtcgatttgcgcggcgaactgctgacc
cacatcaaaacccatcccgaactgcggccgctggaacgggatttgcgcgatctgctgacc
gcttggttcgatgtcggcttccttgatctggaacgcatcacctgggagtcgtcggcctcc
ttcctggaaaagatcatcacctatgaggccgtccacgccatccaaagctgggacgacctg
aaaaaccgccttgatcatgaccgccggctttacgccttcgtccatccgcgaatgccccac
gagccgctgatcttcgtcgaggtcgccctggtcaacggcatctcgggcaccatcggcgat
ctgcttgatcttgaagcgccgctgcttgatccggcccaggccgacaccgcgatcttttat
tcgatctccaacgcccaaagcggtctggcggggatcagttttggcaatttcctgatcaag
cgggtggttgaaaccctgcgccgtgaatttcccggcctcaagaccttctcgaccctgtcg
ccgatccccggcttccgccgctggctcgacggggtcttcgccgagggggatatcggaccg
atgtcgagcgccgagcgcaaggccctgcgcgccgtcgatgatcgcggcgccaagggggcg
ctcaaacgcctgatcgaaaccgacggttggttgaccgaagagggcggggaagaggcggtg
aagggccccctgatgcgcctgcgcgcgcgctatctggcggtcgagcgccgcctgggcagt
ggcgagggcgttgagcgggcctatgatccggtcgcccatttccatctgaccaacggggcg
cgcgtcgagcgcatcaattggcgcggcgatttgtcggccaacggcctgcgccagtcgatg
ggcatgatggtgaactatctctataagctcgacgagatcgagaagaatcacgaagcctat
cagggcaatgccgtcgccgcggtcagcggcacggtgaagactctgctcaaggcctag

DBGET integrated database retrieval system