KEGG   Rhodospirillum rubrum ATCC 11170: Rru_A1592Help
Entry
Rru_A1592         CDS       T00310                                 

Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC:1.1.1.267)
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
rru  Rhodospirillum rubrum ATCC 11170
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rru00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Rru_A1592
Enzymes [BR:rru01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Rru_A1592
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1875399..1876601
Genome map
AA seq 400 aa AA seqDB search
MSGTANGTPRRVSILGSTGSIGKNTLDLIGRSPERYQVVALTANGNAEALAAQAKATRAE
IAVVADEAAYGRLKEALAGSGIEAAAGPQAVCEAAARDADWVMAAIVGAAGLAPTLAAVE
RGATIALANKECLVCAGDLFMAEIRRAGATFLPVDSEHNAIFQVFDFEKKERIERIILTA
SGGPFRDWTREAMAKATPEQAVAHPNWSMGAKISVDSASMFNKGLEFIEAYHIFGIAPER
IEILVHPQSVIHSMVGYVDGSVLAQLGSPDMRTPIAYCLAWPDRMVAPVPHLDFPKLGHM
DFRAPDPDRFPAIRIVRETLRRGGVAPTAMNAANEVAVAGFLGRQIGFLDIPAVVEATIN
DVMAGPLGNQAVDHLDAVMAVDGEARRIAAGHALAHAAAA
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgagcggcacggcgaacggcaccccccggcgggtcagcatcctcgggtccaccggttcc
atcggcaagaacacccttgatctcatcggccgctctcccgagcgctatcaggtggtcgcc
ctgaccgccaatggcaatgccgaggccctggccgcccaggccaaggcgacgcgggccgag
atcgccgtggtcgccgacgaggcggcctatggccggctgaaagaggccctggccggcagt
ggcatcgaagccgccgccgggccgcaagcggtgtgcgaggccgccgcgcgggatgccgat
tgggtgatggccgccatcgtcggcgccgccggtctggccccgaccctggccgccgtggaa
cggggcgccaccatcgccctggccaataaggaatgcctggtctgcgccggcgatctgttc
atggccgagatccgccgcgccggggcgaccttcctgcccgttgattccgaacacaacgcc
atcttccaagtctttgattttgagaagaaagagcgcatcgagcgcatcattttgaccgct
tcgggcggtcccttccgcgactggacgcgcgaggcgatggccaaggccacgcccgagcag
gcggtcgcccatcccaattggtcgatgggcgccaagatcagcgtcgattcggcctcgatg
ttcaacaagggcctggaattcattgaggcctatcacattttcggcatcgcgcccgagcgc
atcgagatcctggtccacccgcaatcggtgatccattcgatggtcggctatgtcgatggc
tcggtgctcgcccaattgggctcgcccgatatgcgcacgccgatcgcctattgtctggct
tggcccgatcgcatggtggccccggtgccccatctcgatttccccaagctgggccacatg
gatttccgcgcgcccgatcccgatcgcttcccggcgatccgcatcgtccgcgagaccctg
cgccggggcggcgtggcgccgacggcgatgaacgccgccaacgaggtggcggtggccggc
ttccttggccgccagatcggcttcctcgatatccccgccgtggtcgaggcgacgatcaac
gatgtcatggccgggcccctgggcaatcaggcggtggaccatcttgacgccgtgatggcc
gtcgatggcgaagcccggcggatcgccgccggtcacgccctggcccacgccgcggccgcc
tga

DBGET integrated database retrieval system