KEGG   Rhodospirillum rubrum ATCC 11170: Rru_A1607Help
Entry
Rru_A1607         CDS       T00310                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
rru  Rhodospirillum rubrum ATCC 11170
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rru00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Rru_A1607
Enzymes [BR:rru01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Rru_A1607
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1898895..1901081
Genome map
AA seq 728 aa AA seqDB search
MTDGTPGVLRVLAERAGVIDRCYDAFGSLMVAPDAALKAALAALGWPAEDEAQAARSLAA
LEAAPWAEALPPCVIHRLGDTPAVLTVPVVTTGDSFGPGRWSLTPEEGAQALPATGTFDP
QSLTVEESGPEGKTRRRLDLGLDLPMGYHRLRVEGLAPTALETVLIVAPRRCWLPEGWED
REGPRLWGVATQVHGLRSLNDWGMGDFDSLAVLARLTGRQGGDLLGVSPLHALFPARPLH
ASPYSPNSRLFLNPLYISIPSVPEYDLSPELAAFTNDLGALQQPELIDLAAVAEGKWSAL
AILHRRFVAQHLGRRTPRGQAFTAFLKEGGEHLEKFAIFQTLSEHFKERGWSWRDWPAEF
HDPAAPAVAAFAGEQAARVLFHQWCQFEADRQLALVAKAAADAGQRVGLYRDLALGSDPT
GADCWALRGVMAEGLSVGAPPDPWNAKGQNWGFPPFHPGHLRQAAYQPFARMIRANMREA
GALRMDHVLGLMRLFCIPWGMEGREGFYLRMPFEDLLAVLALESHRARCIVVGEDLGTVP
DGFRDRMREAAVLSYRLFFFERGHDQALTPPEAYPRLATVAASTHDLPTLAGFWAGRDLA
WKNDLDLFPSEQARNAESMDRHNDRPRIRATLAAAGTPLSDPGTFTPPPELVPAVTAWLA
RTPSLILMLQIEDVLEMPEQANMPGTIDQHPNWRRRIPLAVEALEVDGRLGRLACILASH
GRGAAAKR
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
atgacggacggcacccccggagtattgagggttcttgcggaacgggcaggggttatcgac
cgctgttatgatgctttcggatcgttgatggtcgcccccgacgcggcgctgaaggcggct
ttggcggctttgggctggccggcggaggacgaggcgcaggcggcgcggtcgctggccgcc
cttgaggccgccccctgggccgaggcgctgccgccttgcgtcatccatcgcctgggtgac
acgcccgccgtcctgacggtgccggtggtgacgacgggcgactcgtttggccccggccgc
tggagtctgacccccgaggagggagcgcaagccctaccggcgaccgggaccttcgatcca
caaagcctgacggtcgaggagtcggggccggagggtaagacacggcgccgccttgacctc
ggcctcgatctgccgatggggtatcatcgcctgcgcgtcgagggacttgccccgacggcg
ctggagaccgtgctgatcgtcgcgcccaggcgctgttggctgcccgagggctgggaagac
cgcgaggggccgcgtttgtggggcgtggcgacccaggttcatggcctgcgcagtctcaac
gactggggaatgggcgatttcgactcgttggccgtgctggcgcggctgaccggccgccag
ggcggtgatctgttgggcgtcagcccgcttcacgcgctgtttccggcccgcccgcttcat
gccagcccctattcgcccaactcccggctgttcctcaatccgctctatatctcgatcccc
agcgttccggaatacgacctcagccccgagcttgccgccttcaccaacgatctcggcgcc
cttcagcagcccgaactgatcgatctcgcggcggtcgccgagggcaaatggtcggctttg
gccattcttcaccggcgttttgtcgcccagcacctcggacggcggacgccgcgcggccaa
gcctttaccgccttcctgaaagagggcggggagcaccttgaaaaatttgccattttccag
accctgtccgagcacttcaaggagagggggtggtcgtggcgcgactggccggctgagttt
cacgatccggcggcgccggcggtggccgcgttcgccggcgagcaggcggcccgggtgctg
ttccatcaatggtgccagttcgaggccgatcgccaattggcgctggtggccaaggctgcg
gccgatgccggtcagcgcgtcgggctgtaccgcgacctcgccctggggtccgatcccacc
ggcgccgattgctgggccctgcgcggggtcatggccgaggggttgtcggtgggcgccccc
cccgatccgtggaacgccaagggccagaactggggattcccgccctttcaccccggccac
ctgcgccaagccgcctatcagcccttcgcccggatgatccgcgccaatatgcgcgaggcc
ggggccctgcgcatggatcatgtgctggggctgatgcggctgttttgcattccctggggg
atggagggccgcgagggcttctatctgaggatgcccttcgaggatcttctggccgttctc
gccctggaaagccaccgggcgcgctgcatcgtcgttggcgaagatctgggcaccgtgccc
gacggcttccgcgatcgcatgcgcgaggcggcggtgctgtcttatcggttgttcttcttt
gaacggggccacgatcaggcgctgacccccccggaagcctatccccgcttggccaccgtc
gccgcgtcgacccatgatctgccgaccctggccgggttctgggccgggcgcgatctggcg
tggaaaaacgacctcgatctgtttccctccgagcaggcgcgcaacgccgaaagcatggat
cgccacaacgatcggccgcgaatccgcgcgactctggcggcggcgggaacgccgctgtct
gaccccgggaccttcacgcccccccccgaactggtgccggcggtgacggcgtggctggcc
cgcacccccagccttattctcatgcttcaaattgaagacgtgctggaaatgcccgaacag
gccaatatgccgggaaccatcgatcagcatcccaactggcgccgacgaattccgctggcg
gtggaggctttggaggtggacggaaggctgggccgtctggcatgtatcctggcgtcccac
ggacggggggcggcagcaaaaaggtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system