KEGG   Rhodospirillum rubrum ATCC 11170: Rru_A1771Help
Entry
Rru_A1771         CDS       T00310                                 

Definition
Sec-independent protein translocase TatC
Orthology
K03118  
sec-independent protein translocase protein TatC
Organism
rru  Rhodospirillum rubrum ATCC 11170
Pathway
Protein export
Bacterial secretion system
Module
Twin-arginine translocation (Tat) system
Class
Genetic Information Processing; Folding, sorting and degradation; Protein export [PATH:rru03060]
Environmental Information Processing; Membrane transport; Bacterial secretion system [PATH:rru03070]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2063647..2064618)
Genome map
AA seq 323 aa AA seqDB search
MAPADATRDEDSDLEDKKMPLIDHLIELRSRLLWSTVFFLVAFFACFAYAQEIYNILVLP
LARVMERVGGSQRMIYTALTEAFFTYVKVGAFGAIVLSFPLIATQIWMFVAPGLYRHEKR
AFLPFLIVSPMLFILGAAMVYYLVMPMAWSFLLGFQTTREQTVLPIQLEAKVGEYLGLVM
KLILAFGFSFQMPVALTLMARVGLVTSRGLAKARKYAIVAVFAGAAVITPPDIMSQVMLA
IPLLVLYELSIVAARMVEKSKGIEDDDLENLDDDEPPPAAAAPSTAHKRGGTTALAAPLA
RDEEAGADGDPGRFEETDWNHGH
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggctccggcggacgcgacgcgcgacgaagattccgaccttgaagacaagaaaatgccg
ctgatcgatcatctgatcgaactgcgcagccgtcttttatggtcgacggtgttcttcctt
gtcgcctttttcgcctgtttcgcctatgcccaggaaatctataatattctggtcttgccg
cttgcccgggtgatggagcgggtgggcgggtcgcagcgcatgatctataccgcgctgacc
gaggcgtttttcacctatgtcaaggttggcgcctttggcgcgatcgtgctcagctttccg
ctgatcgccacccagatctggatgttcgtggctcccggattgtaccgccacgagaagcgc
gcctttctgccgttcctcatcgtcagcccgatgttgttcatccttggggcggcgatggtt
tattatcttgttatgccaatggcttggtcgttcttgctcggctttcagacgacgcgcgag
caaaccgttttgccgatccagctggaagccaaggtcggcgaatatcttggcttggtgatg
aagctgatcctggctttcggcttcagcttccagatgcccgtcgccctgacgctgatggcc
cgggttgggctggtcacctcgcgcgggctggccaaggcgcgcaaatacgccatcgtcgcc
gttttcgccggcgccgccgtcatcaccccccccgacatcatgagccaggtgatgctggcc
attccgctgctggtcctctacgagctttcgatcgtcgcggcgcggatggtggaaaagagc
aaggggatcgaagacgacgatcttgagaatctcgacgacgacgagccccctccggcggcc
gcagcgccgtcgaccgcccataagcggggcgggaccacggccttggccgctccgcttgcc
cgcgatgaagaggccggggccgacggcgatccggggcgcttcgaagagaccgactggaat
catgggcattag

DBGET integrated database retrieval system