KEGG   Rhodospirillum rubrum ATCC 11170: Rru_A1789Help
Entry
Rru_A1789         CDS       T00310                                 

Definition
cytochrome-c peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
rru  Rhodospirillum rubrum ATCC 11170
Brite
Enzymes [BR:rru01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     Rru_A1789
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2080153..2081199
Genome map
AA seq 348 aa AA seqDB search
MQRLLRITAACALTLAVAGPAFAADDLRAKAKEVFEVIPTSVPEIKGNAITPARIELGRK
LFFDPRLSRSGLISCNTCHNLGMGGDDNLETSIGHGWQKGPRNAPTVLNAVFNIAQFWDG
RAEDLRTQAKGPVQAGVEMASTPERVVATLKSMPEYVADFKAAFRDDPDPVSFDNMAKAI
EIYEATLITPDSKFDKWLAGDDASMTKLETAGLSLFLDKGCAACHNGVNIGGNGYYPFGV
VEQPGADILPVADKGRFAVTKTATEEYVFRAGPLRNIALTAPYFHSGKVWDLEQAVAVMG
SSQLGETLSESDVKAITAFLTTLTGVMPKVEYPILPVSTRETPKPEGM
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgtcttttaaggatcacggcggcttgcgccctgaccctcgccgtggccggcccg
gccttcgccgccgatgatctgcgggccaaggccaaagaggtcttcgaggtcatcccgacg
tcggttcccgaaatcaaggggaacgccatcaccccggcccgcatcgagcttggccgcaag
cttttcttcgatccgcgcctgtcgcgcagcggcctcatctcctgcaacacctgccacaac
ctgggcatgggcggggatgacaatcttgaaacctcgatcggccacggctggcaaaaggga
ccgcgcaacgcgccgaccgttctgaacgccgtgttcaacatcgcccagttctgggacggc
cgcgccgaagacctgcgcacccaggccaagggccccgtgcaggccggcgtcgagatggcc
agcacgcccgaacgcgtcgtcgccaccttgaagtcgatgcccgaatacgtcgccgacttc
aaagcggccttccgcgacgatcccgatccggtcagcttcgacaacatggccaaggcgatc
gagatctacgaagccacgctgatcacccccgacagcaagttcgacaaatggctcgccggc
gacgacgccagcatgaccaagctggaaaccgccgggctgtcgctgttcctcgataagggc
tgcgcggcctgtcacaacggcgtcaacattggcggcaacggctattatccgttcggcgtg
gtcgaacagccgggcgccgatatcctgcccgtcgccgacaagggccgcttcgccgtgacc
aagacggccaccgaggaatatgtcttccgcgccggccccttgcgcaacatcgccctcacc
gccccctacttccattcgggcaaggtgtgggatctcgagcaggcggtggcggtgatggga
tcgtcccagcttggcgaaaccctgagcgagtccgacgtgaaggcgatcaccgccttcctg
accaccctcaccggcgtcatgcccaaggtggagtatccgatcctgcccgtcagcacccgc
gaaacgcccaagcccgaaggcatgtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system