KEGG   Rhodospirillum rubrum ATCC 11170: Rru_A1858Help
Entry
Rru_A1858         CDS       T00310                                 

Definition
7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
rru  Rhodospirillum rubrum ATCC 11170
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:rru00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2156810..2157295)
Genome map
AA seq 161 aa AA seqDB search
MIYIALGANLAGPAGSPRDTLDAALVALEDAGVVVAARSAWYRTSPVPPSDQPDYVNGVA
RLVTDLDPVALLGLLHRLEDQFGRRRGEINAARTLDLDLLDYDELRRTGAPPLLPHPRMA
ERGFVLFPLREIAPDWRHPVLDQPIDTLIAALAADQAAERL
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgatctatatcgctctcggcgccaatctggccggtccggccggctcgcccagggataca
cttgacgcggcgttggtcgcccttgaggacgccggagtggtggtcgccgcccgctccgcc
tggtatcggacgagcccggttccaccgtccgatcagcccgattacgtgaacggcgtggcc
cgtctggtcaccgacctcgaccccgtcgccctgctcgggctgcttcatcgccttgaggat
caattcgggcgtcggcgcggcgagatcaatgccgcccgcacccttgatctcgatttgctt
gattatgacgagctgcgccggaccggggcgccgccgctgctgccccatccgcgcatggcc
gagcgcggtttcgttttattccccttgcgcgagatcgcgcccgactggcgccacccggtt
cttgaccaaccgatcgacaccctgatcgccgcccttgccgccgatcaggcggcggaacgt
ttgtaa

DBGET integrated database retrieval system