KEGG   Rhodospirillum rubrum ATCC 11170: Rru_A1979Help
Entry
Rru_A1979         CDS       T00310                                 

Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
rru  Rhodospirillum rubrum ATCC 11170
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rru00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Rru_A1979
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Rru_A1979
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Rru_A1979
Enzymes [BR:rru01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Rru_A1979
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2290185..2291543)
Genome map
AA seq 452 aa AA seqDB search
MTESTKYLLSEDRLPKAWYNLAADLPVPLPPPLNPGTLKPLVADDLAPIFPRAVIEQEMS
AERWIDIPEPVREVYRLWRPSPLIRARRLERALDTPAHIYFKYEGVSPAGSHKPNTSVPQ
AFYNQQEGVKKLATETGAGQWGCSLAFAGSLFGLEVQVFMVKVSFNQKPYRRALMETYGA
TCIPSPSPLTEAGRAILARDPESNGSLGIAISEAVEVAIAHDDTKYALGSVLNHVCLHQT
VIGEEALLQMEMAGDEPDVVIACTGGGSNFAGLAFPYIREKIKGRSIRIVGVEPHSCPTL
TKGRYAYDFGDTAKLTPLMKMHTLGATFMPPGSHSGGLRYHGMSPMVSHVKELGLMEARS
YHQTECFAAALQFARNEGIVPAPESSHAVKAAIDEALLAKAEGKARTILFNLSGHGHFDM
QAYTDYLAGKLKDRVFDDSLLDEALADLPVID
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagagtaccaaatacctgctgtccgaagatcggttgcccaaggcctggtacaat
ctggccgccgatctgcccgtgcccctgccgccgccgctcaaccccggaacgctgaagcca
ttggtcgccgatgatctggcgccgatcttcccgcgcgcggtgatcgagcaggagatgagc
gccgagcgctggatcgatatccccgaaccggtgcgcgaggtgtatcgcctgtggcggccg
tcgccgctgatccgcgcccggcggctcgagcgcgcccttgatacccccgcccatatctac
ttcaaatacgaaggcgtgagcccggcgggcagccataagcccaatacctcggtcccccag
gcgttctataaccagcaagagggcgtcaagaagctggcgaccgaaaccggcgccggccaa
tggggctgttcgctggccttcgccggatcgctgttcggcctggaagtccaagtgttcatg
gtcaaggtgtcgttcaatcagaagccctatcgccgggcgctgatggaaacctatggcgcc
acctgcattcccagcccctcgccgctgaccgaggccggccgcgccattctggcccgcgac
ccggagtccaacggctcgctcggcatcgccatttccgaggcggtcgaggtcgccatcgcc
catgacgacaccaaatacgccctgggcagcgtcctcaatcacgtctgcctgcatcagacg
gtgatcggcgaagaagcgctgttacagatggagatggccggcgacgagcccgatgtggtg
atcgcctgcaccggcggcggctcgaacttcgccggactggccttcccctatatccgcgag
aagatcaaggggcggtcgatccgcatcgtcggcgtcgaaccccattcctgcccgaccctg
accaagggccgctatgcctatgatttcggcgatacggccaagctgacgcccttgatgaag
atgcataccctgggcgccaccttcatgccgcccggctcgcattccggcggcctgcgctac
cacggcatgtcgccgatggtcagccacgtcaaggaactgggcctgatggaggcgcggtcc
tatcaccagaccgaatgcttcgccgccgccctgcaattcgcccgcaacgaaggcatcgtt
cccgcacccgagtcttcgcatgcggttaaggccgccatcgacgaagccttgctggccaag
gccgaaggcaaggcgcggacgatcctgttcaatctgtcgggccacggccatttcgacatg
caggcctatacggattatttggccggaaagctcaaggaccgggtgttcgacgacagtctg
cttgacgaagccttggccgatctgccggttatcgactga

DBGET integrated database retrieval system