KEGG   Rhodospirillum rubrum ATCC 11170: Rru_A2009Help
Entry
Rru_A2009         CDS       T00310                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
rru  Rhodospirillum rubrum ATCC 11170
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rru00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Rru_A2009
Enzymes [BR:rru01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Rru_A2009
Exosome [BR:rru04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Rru_A2009
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2322053..2323540
Genome map
AA seq 495 aa AA seqDB search
MPFLLAIDQGTTSSRAIVFDHEGQPIARAQKDLVQYFPGDGWVEHDATAIWEDSLAVARE
ALDRADVAAHAISAIGLTNQRETAVLWERASGQPVHNAIVWQDRRTAALCRELKAQGHEA
LVRRKTGLLIDPYFSATKIGWMLDHDPVLRRRAEAGELAFGTVESWLLYKLTGGAVHASD
ATNAARTLLFDIRANRWDEDLLALFRIPAALLPRVVDNAGRFGETLPGLFGAPIPITGMA
GDQHAAMVGQGCFTRGMIKSTYGTGAFALLNIGQTFVESRNQLLTTLAYRLNGQSTYALE
GSIFVAGAAVQWLRDGLRAISSAAETQVLAEAVADTGGCYMVPAFTGLGAPYWDPEARGA
ILGLTRDTSLEQVARAALEAQGYQTRDLLDAMAADSGTKPLALRVDGGMVANDWVCQFLA
DITGIAVERPRVIETTALGAAALAGLGAGVFASPADLGGQWHRDRLFTPHMPASRRESLY
AGWVQAVRRVASDLR
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgccctttcttcttgccatcgaccagggaaccaccagcagccgggccatcgttttcgat
cacgagggccagccgatcgcccgggcccaaaaggacctggtccagtatttccccggcgat
ggctgggttgaacacgacgcgacggcgatctgggaagacagcttggcggtggcccgcgag
gcgctggaccgggccgatgtcgccgcccatgccatcagcgccatcggcctgaccaatcaa
cgcgaaaccgccgtgctgtgggagcgcgccagcggccagccggttcataacgccatcgtc
tggcaagatcgccgcacggcggcgctgtgccgcgaactgaaggcccagggccatgaggcg
ctggtgcggcgcaagaccggcctgctgatcgatccctatttctcggccaccaagatcggc
tggatgcttgatcacgatccggtgttgcgccggcgggccgaagccggcgagctggcgttc
ggcacggtcgaatcctggctgctctataagctgaccggcggcgccgtccacgccagcgac
gccacgaacgccgcccgcaccttgctgttcgacatccgcgccaaccgttgggacgaggat
cttctggcgctgtttcgcatccccgccgccctgctgccccgggtggtcgataacgccggg
cgctttggcgaaaccctgcccgggctgttcggcgcgccgatcccgatcaccggcatggcc
ggcgaccagcatgccgccatggtcggccagggctgcttcacccggggcatgatcaaatcg
acctatggcaccggcgccttcgccctgctcaacatcggccagaccttcgtcgaaagccgc
aatcaattgctgaccaccctggcctaccggctgaatggccagagcacttatgccctggaa
ggctcgatcttcgtcgccggggcggcggtgcaatggctgcgcgacgggttgcgggcgatt
tccagcgccgccgaaacccaggtcctggccgaagccgtggccgatacgggcggctgctat
atggttccggccttcaccggcctcggcgccccctattgggacccggaggcgcgcggcgcc
atccttggcctgacgcgcgacacctcgcttgaacaggtcgcccgcgccgccctggaggcc
cagggctatcaaacccgcgacctgctcgatgccatggccgccgacagcggcaccaagccg
ctggccctgcgcgtcgatggcggcatggtcgctaatgattgggtctgtcagttcctggcc
gatatcaccggcatcgccgttgaacgcccgcgggtgatcgaaaccacggcgctgggcgcc
gccgccctggccggcctgggagcgggggtcttcgccagcccggccgaccttggcggccaa
tggcaccgcgaccgcctgttcaccccgcatatgcccgccagccgccgcgaaagcctgtac
gccggctgggtccaggcggtgcgccgggtggccagcgatctgcggtaa

DBGET integrated database retrieval system