KEGG   Rhodospirillum rubrum ATCC 11170: Rru_A2146Help
Entry
Rru_A2146         CDS       T00310                                 

Definition
(RefSeq) methyl-accepting chemotaxis sensory transducer
  KO
K03406  
methyl-accepting chemotaxis protein
Organism
rru  Rhodospirillum rubrum ATCC 11170
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:rru00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Rru_A2146
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Rru_A2146
Bacterial motility proteins [BR:rru02035]
 Flagellar system
  Chemotaxis proteins
   MCPs
    Rru_A2146
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
2489568..2491025
Genome map
AA seq 485 aa AA seqDB search
MSREIALLRKGVLRFFIPFLLLQVALVAVAGLITGAAMLAGLAVSALFAAIPVALIFLAG
DSPASRSAIGVGLVIQVAVLVFMFRGHPWQIDIHLYFFAVLAILVVLCDARVILAAALTI
AAHHLILTYAMPAWVFPPGADLGRVALHAAIVIIETVTLVWVIVRMTTSFATAEQAVVEA
NTAREDARKVAEERLRLEAAAAEAQVTAVRGVADDLEGSVGTALGALKDDSATMRRAAEA
LNGSSESSRQVSSMARDLSERTAEGVESMAQAARTMTQSVSGILESVRHSDALSRSALTD
TERATEKVAALSTAAERIGEVVGLISAVAAQTNLLALNATIEAARAGDAGKGFAVVANEV
KTLATQTARATDEIAAQVTGIQGATRDSAAVIATISRSMTDISATVSAIAAAMEDQGKAS
QLVAGTIDAVSSLAHELGEVISRMDGLTGDFSANAATMRGLSDHAVDEIDRLDQSVIAFV
GRLRA
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgagccgcgaaatagccctcctgcggaaaggcgtcttacgcttcttcatcccttttctg
cttcttcaggtcgctttggtcgccgtcgccggactgatcaccggggcggccatgcttgcc
ggtttggcggtctcggcgctcttcgccgcgatcccggtcgcgctgatcttcttggccggg
gatagtccggccagtagaagcgccatcggcgtcggtttggtcattcaggtcgcggtgctg
gttttcatgtttcgcggccatccctggcagatcgacatccacctgtatttcttcgccgtt
ctggccatccttgtggtgctctgcgacgcgagggtcatccttgccgcggcgctgaccatc
gccgcccaccacctgattttgacctacgccatgccggcctgggtcttccccccgggtgcc
gatctcggccgggtggccctgcatgcggccatcgtcatcattgaaaccgtgaccctggtt
tgggtgatcgtgcgcatgaccacgtcgttcgccaccgccgaacaggcggtggtcgaggcc
aataccgcccgcgaagatgcccgcaaggtcgccgaggagcgcttgcgtctggaagccgcc
gccgccgaggcccaggtcaccgccgtgcgcggcgtcgccgatgatctcgaagggtcggtc
ggcacggctttgggcgccctgaaggacgacagcgccaccatgcgccgggcggccgaagcc
ctgaacggatcgtcggaaagctcgcggcaggtatcctcgatggcccgcgatttgtccgaa
cgcacggccgaaggcgttgaatcgatggcccaggcggcgcggacgatgacccaatcggtg
tcgggcatccttgaaagcgtccgtcactccgatgccctgtcgcgctccgccctgaccgat
accgaacgggcgacggaaaaggtcgcggcgctgagcacggcggccgagcggatcggcgag
gtggtcgggctgatcagcgccgtcgccgcccaaaccaatctgctggccctgaacgcgacg
atcgaggcggcgcgggccggcgatgccggcaagggcttcgccgtggtcgccaatgaggtg
aagaccctggccacccaaacggcgcgggcgaccgacgagatcgccgcccaagtgaccggc
atccagggggcgacccgcgactcagcggccgtcatcgccaccatcagccgcagcatgacc
gatatcagcgccaccgtctcggccatcgccgccgccatggaagatcagggaaaagccagt
cagttggtcgccggaaccatcgacgcggtatcgtccctggcccatgaactgggcgaggtg
atctcccgcatggatggcctgaccggcgacttctcggccaatgccgccaccatgcgcggt
ctgtccgatcacgccgtcgacgagatcgaccgccttgatcagtcggtgatcgccttcgtc
ggccgcctgcgcgcctga

DBGET integrated database retrieval system