KEGG   Rhodospirillum rubrum ATCC 11170: Rru_A2168Help
Entry
Rru_A2168         CDS       T00310                                 

Definition
phosphoribosylglycinamide formyltransferase (EC:2.1.2.2)
Orthology
K11175  
phosphoribosylglycinamide formyltransferase 1 [EC:2.1.2.2]
Organism
rru  Rhodospirillum rubrum ATCC 11170
Pathway
Purine metabolism
One carbon pool by folate
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:rru00230]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:rru00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2517422..2518096
Genome map
AA seq 224 aa AA seqDB search
MNAPQSTAPRKRVAVLISGRGSNMEALIAACADPAFPAGIVSVISNRADAKGLERAQAAG
LSTTVIDHKAFAGREPFEAALSAHIEAVGADIICLAGFMRLLTAGFVTRWQDRMINIHPS
LIPAFRGLHTHERVIEAGVRVHGCTVHFVRAEMDDGPIIVQAALPVRPDDTADSLGARVL
TREHQIYPLALRLLAEGKVRVEGNRAIIDAAADDITLINPPLSA
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgaacgctccccaatcgaccgcgccccgcaagcgcgtggcggtactgatcagcgggcgc
ggcagcaatatggaagcgctgatcgcggcttgcgccgatcccgccttccccgccggcatc
gtcagcgtgatttccaaccgcgccgacgccaagggtctggagcgggcgcaagccgccggc
ttgtcgaccacggtgatcgaccacaaggccttcgccgggcgtgaacccttcgaagccgcg
ctcagcgcccatatcgaagccgtcggcgccgatatcatctgtctggcgggcttcatgcgc
ctgctgacggcggggttcgtcacccgctggcaagacaggatgatcaacatccatccgtcg
ctgatcccggccttccgcggcctgcatacccatgaacgggtgatcgaggccggggtgcgc
gttcatggctgcacggttcacttcgtgcgcgccgaaatggacgacggcccgatcatcgtc
caggccgccctgcccgtccgccccgatgataccgccgacagcctgggggcacgggtgctg
acccgggaacatcagatctacccgctggccctgcgcctgctggccgagggcaaggtgcgc
gttgaaggcaatcgcgccatcatcgacgccgccgccgacgatatcaccctgatcaacccg
ccgctcagcgcctga

DBGET integrated database retrieval system