KEGG   Rhodospirillum rubrum ATCC 11170: Rru_A2486Help
Entry
Rru_A2486         CDS       T00310                                 

Definition
(RefSeq) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
rru  Rhodospirillum rubrum ATCC 11170
Pathway
rru00010  Glycolysis / Gluconeogenesis
rru00052  Galactose metabolism
rru00500  Starch and sucrose metabolism
rru00520  Amino sugar and nucleotide sugar metabolism
rru00521  Streptomycin biosynthesis
rru01100  Metabolic pathways
rru01110  Biosynthesis of secondary metabolites
rru01120  Microbial metabolism in diverse environments
rru01130  Biosynthesis of antibiotics
rru01200  Carbon metabolism
Module
rru_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:rru00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rru_A2486
   00052 Galactose metabolism
    Rru_A2486
   00500 Starch and sucrose metabolism
    Rru_A2486
   00520 Amino sugar and nucleotide sugar metabolism
    Rru_A2486
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Rru_A2486
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Rru_A2486
Enzymes [BR:rru01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Rru_A2486
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase
Motif
Other DBs
NCBI-GeneID: 3835920
NCBI-ProteinID: YP_427573
UniProt: Q2RRF9
Position
2890015..2890989
Genome map
AA seq 324 aa AA seqDB search
MAEPFIPGLIADIGGTNARFALTTPEGGWRDERVYRCAAFPGPAEAAAHYLAEVLTAFEP
RPDRGAICVACPVNGDHLALTNHGAWSFSISAVADRLGLAPFHAVNDFIANALAIPRLGP
SGLIEIGGGAGLTGAPIAAIGPGTGLGVAILIPGRGGNRTSPLATEGGHVTLPAVTDREA
VIISALRAIHGHASAERAISGPGLVWLSEAIRAADGLEPVAETPPSVMEKGLARSCPVCA
EAVDTFYALLGTVAGNLVLSTGAQGGVYLMGGILPRHPEALRTSAFLARFHEKGRFRDYL
DVVPIRLVTHPYPAFIGLAGLVSD
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atggctgagccgttcattcccggattgatcgccgatatcggcggcaccaacgcccgcttc
gccctgaccacccccgagggcggctggcgcgacgaacgggtttaccgctgcgccgccttt
cccggcccggccgaggcggcggcccattatctggccgaggtgctgaccgcctttgaaccg
cgccccgatcgcggggcgatctgcgtcgcctgtccggtcaacggcgatcatctggctttg
accaaccatggggcgtggtcgttctcgatcagcgcggtcgccgaccgcttgggtttggcg
cctttccatgcggtcaatgacttcatcgccaacgccctggccatcccccgccttggcccc
tccgggctgatcgagatcggcggcggcgccggacttaccggggcgccgatcgccgcaatc
ggcccgggcaccggtctgggggtggcgatcctcatccccggtcgcggcggcaaccgcacc
agccccctggccaccgagggcggccatgtcaccctgcccgccgtgaccgaccgcgaggcg
gtgatcatcagcgccctgcgcgccattcacggccacgcctcggccgagcgggcgatttcc
ggccccggtctggtttggctgagcgaggcgatccgcgccgccgatggcttggagccggtt
gccgaaaccccgccctcggtgatggaaaagggcttggcgcgcagctgcccggtttgcgcc
gaagccgtcgacaccttttacgcgctgctgggcacggtggcgggcaatctggtgctgagc
accggcgcccagggcggcgtttacctgatgggaggtatcctgccccgacacccagaggcc
ttgcgaacctcggccttcctggcgcgcttccacgaaaagggccgcttccgcgattacctt
gatgtcgtccccattcgcttggtcacccacccctatccggccttcatcggtctggccggg
ctggtcagcgattag

DBGET integrated database retrieval system