KEGG   Rhodospirillum rubrum ATCC 11170: Rru_A2576Help
Entry
Rru_A2576         CDS       T00310                                 

Definition
glycogen branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
rru  Rhodospirillum rubrum ATCC 11170
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:rru00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Rru_A2576
Enzymes [BR:rru01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Rru_A2576
Exosome [BR:rru04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Rru_A2576
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2995103..2997325
Genome map
AA seq 740 aa AA seqDB search
MDPKAYSEAVAALVGARHSNPFAFLGPHEGRAEGGRGGFCIRCFRPKATAVSLISAADDT
VLGRMKRLHPDGLFGIDLPEAPGALAYRLRVSEGDEDRDIEDPYRFGPVLGELDRHLLGE
GTHLDIYRKMGAHPMTRDGVRGTGFALWAPNATRVSVIGDFNGWDGRLHPMRAHPGSGVW
DIFLPGVVEGHLYKYELLGPDGSLLPAKADPYAFQAEKPPHTASVVRGLGTYAWNDGRWM
SERADRVATSAPVSIYEVHLGSWRHGGGDRSLSYREMAEQLIPYVKEMGFTHIELLPVSE
FPFDGSWGYQPIGLFAPTSRFGEPDDFRHFVDRCHQEGVGVILDWVAGHFPEDAHGLSWF
DGTHLYEHSDPRQGRHMDWGTYIFNYGRNEVRNFLLANALFWLEQFHIDGLRVDAVASML
YLDYSRKAGEWVPNKFGGRENLEAIDFLRRMNELVYGRFPGAVTIAEESTAWPMVSRPVH
LGGLGFGYKWNMGWMNDTLSYMSQDPIYRRFHQHDLSFGLLYAFTENFVLPLSHDEVVHG
KRSILGRMPGDAWQQFANLRAYYGFMWTHPGKKLLFMGCEFAQGREWNHNASLDWHLLDI
DWHKGVQALVRDLNGLYAGVPALHDRDTEGYGFSWIDCTDADQSVLAFLRFGETAEDVVM
VVCNFTPNPRHGYRLGAPIAGRWREIFNTDSAHYGGSNMGNSVVETEETKSHGHAQSVVL
TLPPLATIVLRPDGPITRIA
NT seq 2223 nt NT seq  +upstreamnt  +downstreamnt
atggacccgaaagcttattccgaagccgtggccgcccttgtcggggcccgccacagcaat
cccttcgccttcctcggcccccatgagggccgggccgaagggggacgcggcggcttctgc
atccgctgtttccgccccaaggcgacggcggtctcgttgatctcggccgctgatgacacg
gttcttggacggatgaagcgccttcatcccgacggactgttcggcatcgacctgccggag
gctcccggagctctggcctatcgtctgcgcgtcagcgaaggcgacgaggatcgcgatatc
gaagatccctatcgcttcggaccggttcttggcgaactcgaccgccatcttctgggcgag
ggcacccacctcgacatctatcgcaagatgggcgcccatccgatgacccgcgacggcgtt
cgcggcaccggcttcgcgctctgggcgcccaatgccacccgggtcagcgtcatcggcgat
ttcaacggctgggatggccggcttcacccgatgcgcgcccatccgggcagcggggtgtgg
gatatctttctgcccggcgtggtcgaaggccatctctataagtacgaattgctgggcccc
gacggctccttgctgccggccaaggccgatccttacgccttccaggcggaaaagccgccc
cataccgcttcggtggtgcgcggcctgggaacctatgcgtggaacgacggtcgctggatg
agcgagcgggccgaccgcgtcgccacgagcgcgccggtgtcgatctacgaagttcacctc
ggctcgtggcgccatggcggcggcgaccggtcgctgagctaccgggaaatggccgagcag
ctgatcccctatgtcaaggagatggggttcacccatatcgaactgctgccggtcagcgag
ttccccttcgatggctcctggggctatcagccgatcggcctgttcgcgccgaccagccgc
tttggcgaacccgatgatttccgccatttcgtcgaccgctgccatcaggaaggcgtcggc
gtcatcctggattgggtggccggccacttccccgaagacgcccacggcctgtcgtggttc
gatggcacccatctttatgagcattccgacccgcgccagggccggcatatggattggggc
acctatatcttcaattacggccgcaacgaggttcgcaacttcctgctggccaacgccctg
ttctggcttgagcaattccacatcgacggcctgcgcgtcgatgccgtcgcctcgatgctc
tatcttgattattcgcgcaaggccggcgaatgggtccccaataagttcggcggccgcgaa
aacctggaagccatcgatttcctgcgccgaatgaacgagctggtctatggccgcttcccc
ggcgccgtcaccatcgccgaggaaagcaccgcttggccgatggtcagccgtcccgttcat
ctgggcggtctgggctttggctataagtggaacatgggctggatgaacgacacgctcagc
tacatgtcgcaagatccgatctatcgccgtttccatcagcatgatctgagcttcggcctg
ctctacgccttcaccgagaacttcgttctgccgctttcccacgacgaggtcgtccacggc
aagcgctcgatcctcggacggatgcccggcgacgcgtggcaacagttcgccaatctgcgg
gcctattacggcttcatgtggacccatccgggcaagaaactgctgttcatgggctgcgaa
ttcgcccaggggcgcgagtggaaccacaacgccagtctcgattggcatctgctcgatatc
gactggcataagggcgttcaggcgctggtgcgcgatctcaacgggctgtatgccggggtg
cccgccctccacgaccgcgataccgaaggctacgggttctcctggatcgactgcaccgat
gccgatcaatcggttctggccttcctgcgctttggcgaaacggccgaggacgtggtgatg
gtggtttgcaatttcacccccaacccgcgccatggctatcgcctgggcgcgccgatcgcc
ggccgctggcgcgagatcttcaataccgacagcgcccattacggcggctccaatatggga
aattcggtggtggagaccgaggagaccaaaagccacggtcacgcccagtcggtggtgcta
accctgccgccgctggcgaccatcgtgcttcgccccgatggtcccatcacccgcatcgcc
tga

DBGET integrated database retrieval system