KEGG   Rhodospirillum rubrum ATCC 11170: Rru_A2929Help
Entry
Rru_A2929         CDS       T00310                                 

Definition
two component transcriptional regulator (EC:3.1.1.61)
Orthology
K18144  
two-component system, OmpR family, response regulator AdeR
Organism
rru  Rhodospirillum rubrum ATCC 11170
Pathway
beta-Lactam resistance
Module
AdeS-AdeR two-component regulatory system
Brite
KEGG Orthology (KO) [BR:rru00001]
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Rru_A2929
Two-component system [BR:rru02022]
 OmpR family
  AdeS-AdeR [MD:M00655]
   Rru_A2929
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3374529..3375281
Genome map
AA seq 250 aa AA seqDB search
MDMMDEPGLGAAETTPPDRDALILVVEDEPDIADILRAYLERAGMRVVSARDGRRALDLH
ASLNPDLLLLDVQMPVMDGWRVLSELRHRGDTPVIMLTALDQDIDKLMGLRIGADDYVVK
PFNPAEVVARVRAVLRRMGGDGGERARRVLRFGTLRIDLDGHEAMVEDDGGRCLAIDLTL
TEFRLLVHLARTPKRVFSRMELLGACLPEGEALERTVDSHLSKLRKKLEAFGVMGVPTNV
RGVGYRFGGG
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggatatgatggacgagcccggtctcggcgcggcggagaccacaccgcccgacagggac
gcgctgatcctggtcgtcgaagacgaacccgatatcgccgacatcctgagggcctatctc
gaacgcgccggaatgcgcgtcgtaagcgcgcgggacgggcggcgagccttggaccttcac
gcctcgctcaatcccgatttgctgctgctcgatgtgcagatgccggtgatggacggatgg
cgggtgctctccgagctacgccaccgcggcgacacgccggtcatcatgctgacggcgctc
gatcaggacatcgataaactgatgggcttgcgcatcggcgccgatgattacgtggtgaaa
ccgttcaatccggcggaagtcgtcgcccgggtccgcgccgtgctgcgtcgcatgggcgga
gacggcggagagcgggcgcggcgcgtgctgcgtttcggcacgctgaggatcgatctcgac
gggcacgaagccatggtcgaggacgacggcgggcggtgtctggccatcgatctcacgctg
accgaatttcgccttctggttcacttggcccggactcccaaacgggtcttcagccggatg
gagcttctgggcgcctgcctgcccgagggcgaggccctggagcgcaccgttgacagtcat
ctgagcaagttgcgcaagaaactcgaagccttcggcgtgatgggcgtccccaccaatgtt
cgcggcgtcggctatcgcttcggagggggatga

DBGET integrated database retrieval system