KEGG   Rhodospirillum rubrum ATCC 11170: Rru_A3002Help
Entry
Rru_A3002         CDS       T00310                                 

Definition
nicotinamidase (EC:3.5.1.19)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
rru  Rhodospirillum rubrum ATCC 11170
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:rru00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3459252..3459857
Genome map
AA seq 201 aa AA seqDB search
MTDALVLIDIQNDFCPGGALAVPEGDRVVAVANRLAPMFGTVILSQDWHPADHRSFVTAH
PGKAAFESVTMDYGPQVLWPPHCVAGTRGAAFVDGLDLGPAHVIVRKGTNRDTDSYSAFQ
ENDKRTSTGLAGLLRERGIERIFLAGLATDFCVCYSALDARALGFEVCLVEDGCRAIDLD
GSLDLARAKMAAAGVKIVTSP
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacgccctggtgctgatcgatatccagaacgacttctgtcccggtggtgccctg
gccgttcccgaaggcgatcgggtggtggcggtggccaaccggctggcgccgatgttcggc
acggtgatcctcagccaggattggcacccggccgatcaccgctcgtttgtcaccgcccat
cccggcaaggccgccttcgagtccgtgaccatggactacggcccccaggtcttgtggccg
ccccattgcgtggccggaacccggggcgcggcctttgtcgacggcctggatctcggcccg
gcccatgttatcgtgcgcaagggcaccaaccgcgacaccgacagctattcggccttccag
gaaaacgacaagcgcaccagcaccggtctggccgggctgttgcgcgaacgcggcatcgag
cggatcttcctggccggattggcgacggacttctgcgtctgttacagcgccctggacgcc
cgcgccctgggcttcgaggtctgtctggtcgaagacggctgccgggccatcgatcttgac
ggatcgctggaccttgcccgggcgaagatggcggcggccggggtgaagatcgtcaccagc
ccctga

DBGET integrated database retrieval system