KEGG   Rhodospirillum rubrum ATCC 11170: Rru_A3029Help
Entry
Rru_A3029         CDS       T00310                                 

Definition
glucosamine--fructose-6-phosphate aminotransferase (EC:2.6.1.16)
Orthology
K00820  
glucosamine--fructose-6-phosphate aminotransferase (isomerizing) [EC:2.6.1.16]
Organism
rru  Rhodospirillum rubrum ATCC 11170
Pathway
Alanine, aspartate and glutamate metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:rru00520]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:rru00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3486947..3488770)
Genome map
AA seq 607 aa AA seqDB search
MCGIIGIIGVKDVVPSLMEGLRRLEYRGYDSTGIATLVDGVIDRRRAQGKLGNLEKRLVE
APLAGIIGIGHTRWATHGVPNEVNAHPHASAKVAVVHNGIIENFVALRDRLLAKGHVFAT
ATDTEAVVHLITEYLDEGLSPEEAVGKAIGELEGAFALVILIAGEENLLFAARKGSPLAV
GYGDGEMFLGSDALTLAPLTRRIAYLEDGDWVRVTREGAVFRDVSGAIVERKIHLSSVSG
AMIGKGGHRHYMLKEIYEQPQVIGDTLNAMFNPVERTITLPPLPFALDDVERVTLIACGT
SSYAAMVARYWIESIARVPVDLDVGSEFRYRDPPLQAGGLALFISQSGETADTLAALRHC
KAKGLRCLSIVNVAESTMARESDAVLTTLAGPEIGVASTKAFTTQLVVLACLTIALARAK
GQLDADGEARLSKGLTEVPARAAEILKYDEDLRAIAQTVAEARDVLYLGRGTAFPIALEG
ALKLKEISYIHAEGYAAGEMKHGPIALIDETVPVIVIAPSDGLFDKTASNVQEVVARGGK
VIFLSDSEGNRRLGVTPAFSVVLPAVDPFVAPILYAIPVQLLAYHVAVIKGTDVDQPRNL
AKSVTVE
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggcatcatcggcattatcggcgtcaaggacgtggttccctcgttgatggaaggc
ctgaggcggctggaataccggggctatgattccaccggcatcgccaccctggtcgatggc
gtcatcgatcgccgccgggcgcagggcaagctgggcaatctggaaaagcgcctagtcgag
gcgccgctggccggcatcatcggcatcggccatacgcgctgggccacccatggcgtgccc
aatgaggtcaacgcccatccccacgccagcgccaaggtggcggtggttcataacggcatc
atcgagaacttcgttgccctgcgcgatcgcctgctggccaagggccatgtcttcgccacc
gccaccgataccgaggcggtcgtccatctgatcaccgagtacctcgatgagggtctgagc
ccggaagaggcggtgggcaaggcgatcggcgagctggaaggcgccttcgccctggtcatc
ctgatcgccggcgaggaaaacctgctgttcgccgcgcgcaagggcagcccgctggccgtg
ggctatggcgacggcgagatgttccttggctcggacgccctgaccctggcgccgctcacc
cggcgcatcgcctatctggaagatggcgattgggtgcgggtgacccgcgagggcgcggtg
ttccgcgatgtcagcggcgccatcgtcgagcgcaagatccatctgtcgtcggtttcgggg
gcgatgatcggcaagggcggccatcgccactacatgctcaaggaaatctacgagcagccg
caggtgatcggcgacaccctgaacgccatgttcaatccggtcgaacgcacgatcaccctg
ccgccgctgcccttcgccctcgatgatgtggagcgggtgacgctgatcgcttgcggcacc
tcgtcctatgcggcgatggtcgcgcgctattggatcgaatccatcgcccgcgtgcccgtc
gatctcgatgtcggcagtgaattccgctaccgcgatccgccgctgcaagccggcgggctg
gcgctgttcatcagccagtcgggcgagaccgccgataccttggccgcgctccgccactgc
aaggccaagggcctgcgctgcctgtcgatcgtcaatgtggccgaaagcaccatggcccgc
gaatccgacgccgtgctgaccaccctggccggtcccgagatcggcgtcgcctcgaccaag
gccttcaccacccaattggtggttctcgcctgcctgaccattgccctggcccgggccaag
ggtcaacttgatgccgatggcgaggcgcggctctccaaggggttgaccgaggtgccggcg
cgcgccgccgagatcttgaaatacgacgaggacctgcgcgccatcgcccagaccgtggcc
gaggcccgcgacgtgctctatctggggcgcggcaccgccttccccatcgccctggaaggc
gcgctgaagctcaaggaaatcagctatatccacgccgagggctatgcggcgggcgaaatg
aagcacggccccatcgccctgatcgacgaaaccgtgccggtgatcgtcatcgccccatcg
gatggcttgttcgacaagaccgcctcgaacgtccaggaggtcgtcgcccgcggcggcaag
gtgattttcctgtccgatagcgagggcaatcgccgtctgggcgtcaccccggccttttca
gtggtgctgcccgccgtcgatcccttcgtcgccccgatcctctatgcgatcccggtccag
cttctggcctatcacgtcgccgtcatcaaaggcaccgacgtggaccagccgcgcaatctg
gccaagagcgtgacggtcgaatag

DBGET integrated database retrieval system