KEGG   Rhodospirillum rubrum ATCC 11170: Rru_A3029Help
Entry
Rru_A3029         CDS       T00310                                 

Definition
glucosamine--fructose-6-phosphate aminotransferase (EC:2.6.1.16)
Orthology
K00820  
glucosamine--fructose-6-phosphate aminotransferase (isomerizing) [EC:2.6.1.16]
Organism
rru  Rhodospirillum rubrum ATCC 11170
Pathway
Alanine, aspartate and glutamate metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:rru00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Rru_A3029
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Rru_A3029
Enzymes [BR:rru01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.16  glutamine---fructose-6-phosphate transaminase (isomerizing)
     Rru_A3029
Peptidases [BR:rru01002]
 Cysteine Peptidases
  Family C44
   Rru_A3029
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3486947..3488770)
Genome map
AA seq 607 aa AA seqDB search
MCGIIGIIGVKDVVPSLMEGLRRLEYRGYDSTGIATLVDGVIDRRRAQGKLGNLEKRLVE
APLAGIIGIGHTRWATHGVPNEVNAHPHASAKVAVVHNGIIENFVALRDRLLAKGHVFAT
ATDTEAVVHLITEYLDEGLSPEEAVGKAIGELEGAFALVILIAGEENLLFAARKGSPLAV
GYGDGEMFLGSDALTLAPLTRRIAYLEDGDWVRVTREGAVFRDVSGAIVERKIHLSSVSG
AMIGKGGHRHYMLKEIYEQPQVIGDTLNAMFNPVERTITLPPLPFALDDVERVTLIACGT
SSYAAMVARYWIESIARVPVDLDVGSEFRYRDPPLQAGGLALFISQSGETADTLAALRHC
KAKGLRCLSIVNVAESTMARESDAVLTTLAGPEIGVASTKAFTTQLVVLACLTIALARAK
GQLDADGEARLSKGLTEVPARAAEILKYDEDLRAIAQTVAEARDVLYLGRGTAFPIALEG
ALKLKEISYIHAEGYAAGEMKHGPIALIDETVPVIVIAPSDGLFDKTASNVQEVVARGGK
VIFLSDSEGNRRLGVTPAFSVVLPAVDPFVAPILYAIPVQLLAYHVAVIKGTDVDQPRNL
AKSVTVE
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggcatcatcggcattatcggcgtcaaggacgtggttccctcgttgatggaaggc
ctgaggcggctggaataccggggctatgattccaccggcatcgccaccctggtcgatggc
gtcatcgatcgccgccgggcgcagggcaagctgggcaatctggaaaagcgcctagtcgag
gcgccgctggccggcatcatcggcatcggccatacgcgctgggccacccatggcgtgccc
aatgaggtcaacgcccatccccacgccagcgccaaggtggcggtggttcataacggcatc
atcgagaacttcgttgccctgcgcgatcgcctgctggccaagggccatgtcttcgccacc
gccaccgataccgaggcggtcgtccatctgatcaccgagtacctcgatgagggtctgagc
ccggaagaggcggtgggcaaggcgatcggcgagctggaaggcgccttcgccctggtcatc
ctgatcgccggcgaggaaaacctgctgttcgccgcgcgcaagggcagcccgctggccgtg
ggctatggcgacggcgagatgttccttggctcggacgccctgaccctggcgccgctcacc
cggcgcatcgcctatctggaagatggcgattgggtgcgggtgacccgcgagggcgcggtg
ttccgcgatgtcagcggcgccatcgtcgagcgcaagatccatctgtcgtcggtttcgggg
gcgatgatcggcaagggcggccatcgccactacatgctcaaggaaatctacgagcagccg
caggtgatcggcgacaccctgaacgccatgttcaatccggtcgaacgcacgatcaccctg
ccgccgctgcccttcgccctcgatgatgtggagcgggtgacgctgatcgcttgcggcacc
tcgtcctatgcggcgatggtcgcgcgctattggatcgaatccatcgcccgcgtgcccgtc
gatctcgatgtcggcagtgaattccgctaccgcgatccgccgctgcaagccggcgggctg
gcgctgttcatcagccagtcgggcgagaccgccgataccttggccgcgctccgccactgc
aaggccaagggcctgcgctgcctgtcgatcgtcaatgtggccgaaagcaccatggcccgc
gaatccgacgccgtgctgaccaccctggccggtcccgagatcggcgtcgcctcgaccaag
gccttcaccacccaattggtggttctcgcctgcctgaccattgccctggcccgggccaag
ggtcaacttgatgccgatggcgaggcgcggctctccaaggggttgaccgaggtgccggcg
cgcgccgccgagatcttgaaatacgacgaggacctgcgcgccatcgcccagaccgtggcc
gaggcccgcgacgtgctctatctggggcgcggcaccgccttccccatcgccctggaaggc
gcgctgaagctcaaggaaatcagctatatccacgccgagggctatgcggcgggcgaaatg
aagcacggccccatcgccctgatcgacgaaaccgtgccggtgatcgtcatcgccccatcg
gatggcttgttcgacaagaccgcctcgaacgtccaggaggtcgtcgcccgcggcggcaag
gtgattttcctgtccgatagcgagggcaatcgccgtctgggcgtcaccccggccttttca
gtggtgctgcccgccgtcgatcccttcgtcgccccgatcctctatgcgatcccggtccag
cttctggcctatcacgtcgccgtcatcaaaggcaccgacgtggaccagccgcgcaatctg
gccaagagcgtgacggtcgaatag

DBGET integrated database retrieval system