KEGG   Rhodospirillum rubrum ATCC 11170: Rru_A3190Help
Entry
Rru_A3190         CDS       T00310                                 

Definition
(RefSeq) aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
rru  Rhodospirillum rubrum ATCC 11170
Pathway
rru00240  Pyrimidine metabolism
rru00250  Alanine, aspartate and glutamate metabolism
rru01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rru00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Rru_A3190
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Rru_A3190
Enzymes [BR:rru01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Rru_A3190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace Peripla_BP_4
Motif
Other DBs
NCBI-GeneID: 3836636
NCBI-ProteinID: YP_428272
UniProt: Q2RPG0
Position
3679306..3680265
Genome map
AA seq 319 aa AA seqDB search
MSAILFPEYTHRHLLGIEGLVPVEVTALLDRAEIYANRNRSANKVSDEMRGRTVINLFFE
NSTRTRTSFELAARRLGADVINMQVGSSSVAKGETLIDTAVTLNAMHPDVLVVRHAESGA
AALLAQKVNCAVINAGDGAHEHPTQALLDALTIRRRKGRLGGLDVAICGDVLHSRVARSN
IHLLTLMGARVRVVGPRPLIPSGIGELGVDIFHDMREGLRGVDIVMMLRIQMERMQGNFI
PSVREYFRYFGLDREKLALAKPDALIMHPGPMNRGVEIDSDVADDFERSVIREQVEMGVA
VRMAVLEVLSGNLASMETA
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcgatcttgttccccgaatacacccaccgccatctgctcggaatcgaaggcctg
gtgcccgtcgaggtcaccgccctgctcgaccgcgccgagatctacgccaaccgcaatcgc
tcggccaacaaggtcagcgacgagatgcgggggcgcacggtcatcaacctgttcttcgaa
aattcgacgcgcacccgcaccagcttcgaactggcggcgcggcgcctgggcgccgatgtc
atcaacatgcaggtgggctcgagcagtgtcgccaagggggaaaccctgatcgacaccgcc
gtcaccctcaacgccatgcatcccgatgtgctggtggtccgccatgccgagtcgggcgcg
gcggccctgctcgcccaaaaggtcaattgcgcggtcatcaacgccggcgacggcgcccac
gagcatccgacccaggccctgctcgacgccctgaccatccgccggcgcaagggccggctg
ggcgggctggacgtggcgatctgcggcgatgttctgcattcgcgggtggcgcggtccaac
atccacttgctgaccctgatgggggcgcgggtgcgcgttgtcggaccacggccgctgatc
ccctcgggcatcggcgaattgggcgtcgatatcttccatgacatgcgcgaaggcctgcgc
ggcgttgatatcgtgatgatgctgcgcatccagatggagcgcatgcagggcaacttcatt
cccagcgtgcgcgaatacttccgctatttcggcctcgaccgcgagaaactggccctggcc
aagcccgatgccctgatcatgcatccgggaccgatgaatcgcggggtcgagatcgattcc
gacgtggccgatgatttcgaacgcagcgtgatccgggagcaggtggaaatgggcgtcgcg
gtgcgcatggcggttctcgaggtgctgtcgggcaacctcgcctcgatggagaccgcataa

DBGET integrated database retrieval system