KEGG   Rhodospirillum rubrum ATCC 11170: Rru_A3210Help
Entry
Rru_A3210         CDS       T00310                                 

Definition
DNA methylase N-4/N-6 (EC:2.1.1.72)
Orthology
K13581  
modification methylase [EC:2.1.1.72]
Organism
rru  Rhodospirillum rubrum ATCC 11170
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3700630..3701733
Genome map
AA seq 367 aa AA seqDB search
MTDPLRTNRIYQGDSIEVMRSLPSASIDMIFADPPYNMMLGGELLRPDNSRVDGVDDEWD
RFESQRAYAEFTRSWLREARRLLKDNGTIWVIGSYHNIYRVGAELQDLGFWTLNDVVWRK
ANPMPNFKGTRFTNAHETLLWCAKSAEARYTFNYEAMKSLNEGLQMRSDWTLPLCNGKER
LKAEDGKKVHPTQKPESLLYRVILSSTHPGDIILDPFFGTGTTGAVAKLLGRQWIGLERD
EAYIAAARQRIAQVEPIKDLRLLITPSKKSEPRIPFGTVVERGLLAPGSLLCDSQRRWTA
KVRADGTLVATSSHGDHRGSIHQVGAAVQGAPACNGWTFWHIDRPGGAVPIDVLRQQVRA
ELEACAL
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacccgctgcgcaccaatcgcatctatcagggcgacagcatcgaggtgatgcgg
tcgctgcccagcgcctcgatcgacatgatcttcgccgacccgccctataacatgatgctg
ggcggcgaactgctgcgccccgacaacagccgggtcgatggcgtcgatgacgaatgggac
cgcttcgaaagccagcgcgcctatgccgagttcactcggagctggctgcgcgaggcgcgg
cgcctgctgaaagacaacggcaccatctgggtgatcggcagctaccacaatatctatcgg
gtcggcgccgagctgcaggatctggggttctggacgctgaacgacgtggtctggcgcaaa
gccaacccgatgccgaacttcaagggcacccgcttcaccaatgcccatgaaaccctgctg
tggtgcgccaaatcggccgaggcccgctacaccttcaattacgaggcgatgaaaagcctg
aacgaaggcttgcagatgcgcagcgattggacgctgccgctgtgcaacggcaaggagcgc
ctgaaggccgaggacggcaagaaggtccatcccacccaaaagcccgaaagcctgctttat
cgggtgatcttgtcgtcgacccatccgggcgacatcatcctcgatccgtttttcggcacc
ggcaccaccggggccgtcgccaaattgcttggtcgccagtggatcggcctggaacgcgac
gaagcctatatcgccgccgcccgccagcgcatcgcccaggtcgaaccgatcaaggatctg
cggctgctgatcacgccgtcgaagaaatccgaaccgcgcattccctttggcaccgtggtc
gaacgcggcctgctcgccccgggcagcctgctttgcgattcccagcggcggtggacagcc
aaggtccgcgccgatggcacgctggtcgccacctcgtcccatggcgatcatcgcggctcg
atccatcaggtcggtgccgccgtccaaggcgctccggcctgcaatggctggacgttctgg
catatcgaccgccccggcggcgccgttcccatcgacgtgctgcgccagcaggtacgggcc
gaactggaagcctgcgccctttag

DBGET integrated database retrieval system