KEGG   Rhodospirillum rubrum ATCC 11170: Rru_A3343Help
Entry
Rru_A3343         CDS       T00310                                 

Definition
pyrimidine 5-nucleotidase
Orthology
K07025  
putative hydrolase of the HAD superfamily
Organism
rru  Rhodospirillum rubrum ATCC 11170
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3855304..3856020
Genome map
AA seq 238 aa AA seqDB search
MEDKMTRPAEGFETWLFDLDNTLYPASADLFAQIDLRMKAYIGRLLGLPPEEAFRLQKHY
YHTYGTSLRGLMDEHAIDPADFLAFVHDIDHTVLAADPVLGGLLARLPGRKIVFTNGSTR
HALAVLDRLGITDHFEAIHDIAASGFIPKPQPACYDDLIARYGLDPATTIMVEDSHKNLQ
PAAALGMTTLLVRNTLHWAAVEDGGAPMAYCHHVTDDLRIWLADWLAHQAPHPEVCLD
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atggaggacaagatgacaagaccggccgagggctttgagacttggctcttcgatcttgat
aataccctctatcccgcctccgccgatctgttcgcccagatcgatctgcggatgaaggcc
tatatcgggcggctgcttggcctgccgcccgaagaggcgtttcgcctgcaaaagcattac
taccacacctatgggacctcgctgcgcggcttgatggacgaacacgccatcgatccggcc
gacttcctggccttcgtccacgatatcgaccataccgtcctcgccgccgatccggtcctg
ggcgggcttctcgcccgccttcccgggcgcaagatcgtcttcaccaatggcagcacccgc
catgccctggcggttctcgaccgactcggcatcaccgatcacttcgaagcgatccatgat
atcgccgccagcggcttcattcccaagccgcagcccgcctgttacgacgatcttatcgcc
cgctatggccttgatccggcgacgacgatcatggtcgaggattcccataagaatctccaa
ccggcggcggcgctgggcatgaccacccttctcgtgcgcaataccctccattgggctgcc
gtcgaggacgggggcgcccccatggcttattgccatcatgtgaccgacgatctgcggatc
tggctggccgactggctggcccaccaggccccccatccggaagtctgcttagattaa

DBGET integrated database retrieval system