KEGG   Rhodospirillum rubrum ATCC 11170: Rru_A3407Help
Entry
Rru_A3407         CDS       T00310                                 

Definition
(RefSeq) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
rru  Rhodospirillum rubrum ATCC 11170
Pathway
rru00010  Glycolysis / Gluconeogenesis
rru00030  Pentose phosphate pathway
rru00051  Fructose and mannose metabolism
rru00052  Galactose metabolism
rru00680  Methane metabolism
rru01100  Metabolic pathways
rru01110  Biosynthesis of secondary metabolites
rru01120  Microbial metabolism in diverse environments
rru01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:rru00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rru_A3407
   00030 Pentose phosphate pathway
    Rru_A3407
   00051 Fructose and mannose metabolism
    Rru_A3407
   00052 Galactose metabolism
    Rru_A3407
  Energy metabolism
   00680 Methane metabolism
    Rru_A3407
Enzymes [BR:rru01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Rru_A3407
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     Rru_A3407
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 3836859
NCBI-ProteinID: YP_428488
UniProt: Q2RNU4
Position
3924018..3925232
Genome map
AA seq 404 aa AA seqDB search
MFKGKVVVAQGGGPTAVINQSMVGAVLESRKFRNVELVYGAVHGVRGIVDEHFLDLTQET
THNLEMVAETPSSALGSTREKPDLKYCQEIFKVLKAHEIGYFFYIGGNDSSDTVRIVSEE
AAKADYGLRCIHIPKTIDNDLVVNDHTPGFPSAARFVAQAFSGVNLDNQALPGVYIGVVM
GRHAGFLTAASALGKKFQDDGPHLIYLPERTFDVDTFVSDVKEVYDRTGRCIVAVSEGIH
DASGEPIITKLAEEVERDAHGNVQLSGTGALADLLVSVVKKKSGIKRVRGDTLGYLQRSF
VGCVSDVDQREAREVGEKAVQYAMWGQTNGSVTIHRTGFYSVDYQLTPLLDVAGKTRTMP
DSFIAANGHDVTTDFLMYLRPLLGRGMPDAYRLRDNRVAKVLNR
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgttcaagggcaaggtcgttgtcgcccaaggcggcggccccacggccgtcatcaaccag
tcgatggttggcgcggttttggaatcgcgtaagttccgcaatgttgagctggtttatggc
gccgttcatggtgtgcgcggcatcgtcgacgagcatttcctcgacctgacccaggaaacc
acccataacctggaaatggtcgccgaaacgccgtcttcggctttgggatcgacccgcgag
aagcccgatctcaaatactgccaggagatcttcaaggtcctcaaggcccatgagatcggc
tatttcttctatatcggcggcaatgattcctccgataccgtgcgcatcgtctcggaagag
gcggccaaggccgattacggtctgcgctgcattcatatccccaagacgatcgacaacgat
ctggtggtcaacgaccatacgccgggcttcccctcggcggcgcgcttcgtcgcccaggcc
ttcagcggcgtcaatctcgacaatcaggccctgcccggcgtttatatcggcgtggtgatg
ggccgtcatgccggcttcctgacggcggccagcgcacttggcaagaagttccaggacgac
ggcccgcatctgatctacctgcccgaacgcaccttcgatgtcgacaccttcgtctctgac
gtcaaggaggtctatgaccggactgggcgctgcatcgtggcggtcagcgagggcatccac
gacgcctcgggcgagccgatcatcaccaagctggccgaggaggtcgaacgcgacgcccat
ggcaacgtccagctttcgggcaccggcgccctggccgacctgctggtcagcgtcgtcaag
aagaagagcggcatcaagcgggtgcgcggcgataccttgggctatctgcagcgcagcttc
gtcggctgcgtctccgacgtcgaccagcgcgaagcccgcgaagtcggcgaaaaggccgtg
caatacgccatgtggggtcagaccaacgggtcggtcaccatccatcgcaccggcttctat
tcggtcgattatcagctgacgccgctgcttgatgtcgccggcaagacgcggaccatgccc
gattcgttcatcgccgcgaacggccatgacgtgaccaccgatttcctgatgtacctgcgg
ccgttgctgggccgtggcatgcccgacgcctatcgcctgcgcgacaatcgggttgccaag
gttctcaaccgctaa

DBGET integrated database retrieval system